VAMP-2 Antibody (8X9D9)

Novus Biologicals | Catalog # NBP3-16362

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8X9D9 expressed in HEK293
View all VAMP-2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VAMP-2 (P63027). MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VAMP-2 Antibody (8X9D9)

Western Blot: VAMP-2 Antibody (8X9D9) [NBP3-16362]

Western Blot: VAMP-2 Antibody (8X9D9) [NBP3-16362]

Western Blot: VAMP-2 Antibody (8X9D9) [NBP3-16362] - Western blot analysis of extracts of various cell lines, using VAMP-2 Rabbit mAb (NBP3-16362) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry: VAMP-2 Antibody (8X9D9) [NBP3-16362]

Immunohistochemistry: VAMP-2 Antibody (8X9D9) [NBP3-16362]

Immunohistochemistry: VAMP-2 Antibody (8X9D9) [NBP3-16362] - Immunofluorescence analysis of mouse eye using VAMP-2 Rabbit mAb (NBP3-16362) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: VAMP-2 Antibody (8X9D9) [NBP3-16362]

Western Blot: VAMP-2 Antibody (8X9D9) [NBP3-16362]

Western Blot: VAMP-2 Antibody (8X9D9) [NBP3-16362] - Western blot analysis of extracts of RD cells, using VAMP-2 Rabbit mAb (NBP3-16362) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry: VAMP-2 Antibody (8X9D9) [NBP3-16362]

Immunohistochemistry: VAMP-2 Antibody (8X9D9) [NBP3-16362]

Immunohistochemistry: VAMP-2 Antibody (8X9D9) [NBP3-16362] - Immunofluorescence analysis of rat eye using VAMP-2 Rabbit mAb (NBP3-16362) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
VAMP-2 Antibody (8X9D9)

Immunocytochemistry/ Immunofluorescence: VAMP-2 Antibody (8X9D9) [NBP3-16362] -

Immunocytochemistry/ Immunofluorescence: VAMP-2 Antibody (8X9D9) [NBP3-16362] - Confocal imaging of paraffin-embedded Rat eye using VAMP-2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
VAMP-2 Antibody (8X9D9)

Immunocytochemistry/ Immunofluorescence: VAMP-2 Antibody (8X9D9) [NBP3-16362] -

Immunocytochemistry/ Immunofluorescence: VAMP-2 Antibody (8X9D9) [NBP3-16362] - Confocal imaging of paraffin-embedded Mouse brain using VAMP-2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
VAMP-2 Antibody (8X9D9)

Immunocytochemistry/ Immunofluorescence: VAMP-2 Antibody (8X9D9) [NBP3-16362] -

Immunocytochemistry/ Immunofluorescence: VAMP-2 Antibody (8X9D9) [NBP3-16362] - Confocal imaging of paraffin-embedded Mouse eye using VAMP-2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

Applications for VAMP-2 Antibody (8X9D9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: VAMP-2

Vesicle-associated membrane protein (VAMP), also known as synaptobrevin, is an 18 kDa integral membrane protein localized to the cytoplasmic surface of synaptic vesicle (2). VAMP consists of a proline-rich amino-terminal region, a highly conserved hydrophilic domain, followed by a transmembrane anchor and a carboxylterminal tail (3). Two VAMP homologs, VAMP1 and VAMP2, are differentially expressed in the nervous system (3). VAMP1 expression is localized to neurons involved in modulating overlapping patterns, whereas VAMP2 is found in neurons ssociated with autonomic, sensory and integrative functions. In non-neuronal tissues, VAMP1 is restricted to pancreas and kidney tubular cells, whereas VAMP2 is predominantly expressed in Langerhans islets and glomerular cells (4). Evidences for VAMP

Long Name

Vesicle-Associated Membrane Protein 2

Alternate Names

SYB2, VAMP2

Gene Symbol

VAMP2

Additional VAMP-2 Products

Product Documents for VAMP-2 Antibody (8X9D9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VAMP-2 Antibody (8X9D9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VAMP-2 Antibody (8X9D9)

There are currently no reviews for this product. Be the first to review VAMP-2 Antibody (8X9D9) and earn rewards!

Have you used VAMP-2 Antibody (8X9D9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies