VDAC1 Antibody (6B1K1)

Novus Biologicals | Catalog # NBP3-15871

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6B1K1 expressed in HEK293
View all VDAC1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC1 (P21796). MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for VDAC1 Antibody (6B1K1)

VDAC1 Antibody (6B1K1)

Western Blot: VDAC1 Antibody (6B1K1) [VDAC1] -

Western Blot: VDAC1 Antibody (6B1K1) [VDAC1] - Western blot analysis of various lysates using VDAC1 Rabbit mAb at 1:5000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 15s.
VDAC1 Antibody (6B1K1)

Immunohistochemistry-Paraffin: VDAC1 Antibody (6B1K1) [NBP3-15871] -

Immunohistochemistry-Paraffin: VDAC1 Antibody (6B1K1) [NBP3-15871] - Human colon carcinoma tissue using VDAC1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
VDAC1 Antibody (6B1K1)

Immunohistochemistry-Paraffin: VDAC1 Antibody (6B1K1) [NBP3-15871] -

Immunohistochemistry-Paraffin: VDAC1 Antibody (6B1K1) [NBP3-15871] -Human thyroid cancer tissue using VDAC1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
VDAC1 Antibody (6B1K1)

Immunohistochemistry-Paraffin: VDAC1 Antibody (6B1K1) [NBP3-15871] -

Immunohistochemistry-Paraffin: VDAC1 Antibody (6B1K1) [NBP3-15871] -Mouse kidney tissue using VDAC1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
VDAC1 Antibody (6B1K1)

Immunocytochemistry/ Immunofluorescence: VDAC1 Antibody (6B1K1) [VDAC1] -

Immunocytochemistry/ Immunofluorescence: VDAC1 Antibody (6B1K1) [VDAC1] - Confocal imaging of NIH/3T3 cells using VDAC1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
VDAC1 Antibody (6B1K1)

Immunocytochemistry/ Immunofluorescence: VDAC1 Antibody (6B1K1) [VDAC1] -

Immunocytochemistry/ Immunofluorescence: VDAC1 Antibody (6B1K1) [VDAC1] - Confocal imaging of HeLa cells using VDAC1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
VDAC1 Antibody (6B1K1)

Immunohistochemistry: VDAC1 Antibody (6B1K1) [VDAC1] -

Immunohistochemistry: VDAC1 Antibody (6B1K1) [VDAC1] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using VDAC1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
VDAC1 Antibody (6B1K1)

Immunohistochemistry: VDAC1 Antibody (6B1K1) [VDAC1] -

Immunohistochemistry: VDAC1 Antibody (6B1K1) [VDAC1] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using VDAC1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for VDAC1 Antibody (6B1K1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: VDAC1

VDAC1 is an outer membrane mitochondrial protein. The VDAC proteins are thought to form aqueous channels, or pores, through which adenine nucleotides cross the outer mitochondrial membrane. VDACs have been implicated in the formation of the mitochondrial permeability transition pore complex in apoptotic cells. This complex, formed by VDAC, adenine nucleotide translocator (ANT), and cyclophilin D (CypD), is thought to allow the mitochondria to undergo metabolic uncoupling and irreversible morphologic changes that ultimately destroy the mitochondria during apoptosis. VDACs are highly expressed in heart, liver and skeletal muscle, where concentrations of mitochondria are at their highest.

Long Name

Voltage-dependent anion-selective channel protein 1

Alternate Names

hVDAC1, Plasmalemmal porin, Porin 31HL, Porin 31HM, VDAC, VDAC-1

Gene Symbol

VDAC1

Additional VDAC1 Products

Product Documents for VDAC1 Antibody (6B1K1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VDAC1 Antibody (6B1K1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for VDAC1 Antibody (6B1K1)

Customer Reviews for VDAC1 Antibody (6B1K1) (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used VDAC1 Antibody (6B1K1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • VDAC1 Antibody (6B1K1)
    Name: Mehdi Heidari Horestani
    Application: Immunohistochemistry-Frozen
    Sample Tested: HEK 293T cells and Mouse brain
    Species: Human and Mouse
    Verified Customer | Posted 05/08/2026
    Mouse was perfused with PFA and the primary antibody for IF was used at a dilution ratio of 1:50. HEK293T cells were fixed with 4% PFA. The primary antibody dilution was 1:50.
    Mouse was perfused with PFA, and brain sections were prepared using a cryosectioning method. The primary antibody for IF was used at a dilution ratio of 1:50. HEK293T cells were seeded and fixed with 4% PFA. The primary antibody for IF was used at a dilution ratio of 1:50.
    VDAC1 Antibody (6B1K1) NBP3-15871

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies