Versican Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85432

Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Predicted:

Mouse (90%). Backed by our 100% Guarantee.

Applications

Validated:

Multiplex Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, COMET

Cited:

Immunohistochemistry-Paraffin, Flow Cytometry, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Versican Antibody - BSA Free

Versican Antibody - BSA Free

Detection of Versican in Human Brain Glioblastoma via seqIF™ staining on COMET™

Versican was detected in immersion fixed paraffin-embedded sections of human brain Glioblastoma using Rabbit Anti-Human Versican Monoclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37 ° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the astrocytes showing cytoplasmic staining. Protocol available in COMET™ Panel Builder.
Versican Antibody - BSA Free

Detection of Versican in Human B-Cell Lymphoma via seqIF™ staining on COMET™

Versican was detected in immersion fixed paraffin-embedded sections of human B-Cell Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder.
Versican Antibody - BSA Free

Detection of Versican in Human Lymph Node via seqIF™ staining on COMET™

Versican was detected in immersion fixed paraffin-embedded sections of human Lymph Node using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder.
Versican Antibody - BSA Free

Detection of Versican in Human Hodgkin Lymphoma via seqIF™ staining on COMET™

Versican was detected in immersion fixed paraffin-embedded sections of human Hodgkin Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]

Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]

Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human uterine cervix shows strong positivity in the extracellular matrix.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]

Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]

Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]

Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]

Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human stomach shows moderate positivity in extracellular matrix.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]

Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]

Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human tonsil shows no positivity as expected.
Versican Antibody

Western Blot: Versican Antibody [NBP1-85432] -

nbp1-85432_rabbit-polyclonal-versican-antibody-2552023151495.jpg
Versican Antibody

Western Blot: Versican Antibody [NBP1-85432] -

Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. (B) Western blot illustrating the effects of treatment with cancer cell-derived conditioned medium (CM) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. TGF-beta 1 treatment (1 & 10 ng/ml) was included as a positive control. Tubulin was used as loading control (A, B). Image collected & cropped by CiteAb from the following publication (https://www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Versican Antibody

Western Blot: Versican Antibody [NBP1-85432] -

Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. (B) Western blot illustrating the effects of treatment with cancer cell-derived conditioned medium (CM) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. TGF-beta 1 treatment (1 & 10 ng/ml) was included as a positive control. Tubulin was used as loading control (A, B). Image collected & cropped by CiteAb from the following publication (https://www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Versican Antibody

Immunohistochemistry: Versican Antibody [NBP1-85432] -

Immunohistochemistry: Versican Antibody [NBP1-85432] - Immunohistochemical staining of stromal protein expression in DCIS with sclerotic or myxoid stromaMicrophotographs displaying HE staining (A-B), & IHC staining for biglycan (C-D), decorin (E-F) & versican (G-H). Panels A-C-E-G display photographs of one DCIS lesion with sclerotic stroma; panels B-D-F-H display one DCIS lesion with myxoid stroma. This figure illustrates that myxoid DCIS present reduced periductal decorin staining & tend to have increased periductal versican & biglycan expression, whereas sclerotic DCIS generally present strong stromal decorin immunoreactivity, & tend to lack stromal versican & biglycan. Original magnification 100x. Image collected & cropped by CiteAb from the following publication (https://www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Versican Antibody

Immunohistochemistry: Versican Antibody [NBP1-85432] -

Immunohistochemistry: Versican Antibody [NBP1-85432] - Immunohistochemical staining of stromal protein expression in DCIS with sclerotic or myxoid stromaMicrophotographs displaying HE staining (A-B), & IHC staining for biglycan (C-D), decorin (E-F) & versican (G-H). Panels A-C-E-G display photographs of one DCIS lesion with sclerotic stroma; panels B-D-F-H display one DCIS lesion with myxoid stroma. This figure illustrates that myxoid DCIS present reduced periductal decorin staining & tend to have increased periductal versican & biglycan expression, whereas sclerotic DCIS generally present strong stromal decorin immunoreactivity, & tend to lack stromal versican & biglycan. Original magnification 100x. Image collected & cropped by CiteAb from the following publication (https://www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Versican Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Multiplex Immunofluorescence

10ug/mL
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Versican

Versican is a member of the aggrecan/versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

CSPG2, GHAP, PG-M, VCAN

Entrez Gene IDs

1462 (Human)

Gene Symbol

VCAN

UniProt

Additional Versican Products

Product Documents for Versican Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Versican Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Versican Antibody - BSA Free

Customer Reviews for Versican Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Versican Antibody - BSA Free and earn rewards!

Have you used Versican Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies