Versican Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85432
Loading...
Key Product Details
Validated by
Biological Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Predicted:
Mouse (90%). Backed by our 100% Guarantee.
Applications
Validated:
Multiplex Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, COMET
Cited:
Immunohistochemistry-Paraffin, Flow Cytometry, Immunocytochemistry/ Immunofluorescence, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Versican Antibody - BSA Free
Detection of Versican in Human Brain Glioblastoma via seqIF™ staining on COMET™
Versican was detected in immersion fixed paraffin-embedded sections of human brain Glioblastoma using Rabbit Anti-Human Versican Monoclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37 ° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the astrocytes showing cytoplasmic staining. Protocol available in COMET™ Panel Builder.Detection of Versican in Human B-Cell Lymphoma via seqIF™ staining on COMET™
Versican was detected in immersion fixed paraffin-embedded sections of human B-Cell Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder.Detection of Versican in Human Lymph Node via seqIF™ staining on COMET™
Versican was detected in immersion fixed paraffin-embedded sections of human Lymph Node using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder.Detection of Versican in Human Hodgkin Lymphoma via seqIF™ staining on COMET™
Versican was detected in immersion fixed paraffin-embedded sections of human Hodgkin Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder.Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human uterine cervix shows strong positivity in the extracellular matrix.Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human cerebral cortex shows strong positivity in neuropil.Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human stomach shows moderate positivity in extracellular matrix.Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432]
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human tonsil shows no positivity as expected.Western Blot: Versican Antibody [NBP1-85432] -
Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. (B) Western blot illustrating the effects of treatment with cancer cell-derived conditioned medium (CM) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. TGF-beta 1 treatment (1 & 10 ng/ml) was included as a positive control. Tubulin was used as loading control (A, B). Image collected & cropped by CiteAb from the following publication (https://www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Versican Antibody [NBP1-85432] -
Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. (B) Western blot illustrating the effects of treatment with cancer cell-derived conditioned medium (CM) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. TGF-beta 1 treatment (1 & 10 ng/ml) was included as a positive control. Tubulin was used as loading control (A, B). Image collected & cropped by CiteAb from the following publication (https://www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: Versican Antibody [NBP1-85432] -
Immunohistochemistry: Versican Antibody [NBP1-85432] - Immunohistochemical staining of stromal protein expression in DCIS with sclerotic or myxoid stromaMicrophotographs displaying HE staining (A-B), & IHC staining for biglycan (C-D), decorin (E-F) & versican (G-H). Panels A-C-E-G display photographs of one DCIS lesion with sclerotic stroma; panels B-D-F-H display one DCIS lesion with myxoid stroma. This figure illustrates that myxoid DCIS present reduced periductal decorin staining & tend to have increased periductal versican & biglycan expression, whereas sclerotic DCIS generally present strong stromal decorin immunoreactivity, & tend to lack stromal versican & biglycan. Original magnification 100x. Image collected & cropped by CiteAb from the following publication (https://www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: Versican Antibody [NBP1-85432] -
Immunohistochemistry: Versican Antibody [NBP1-85432] - Immunohistochemical staining of stromal protein expression in DCIS with sclerotic or myxoid stromaMicrophotographs displaying HE staining (A-B), & IHC staining for biglycan (C-D), decorin (E-F) & versican (G-H). Panels A-C-E-G display photographs of one DCIS lesion with sclerotic stroma; panels B-D-F-H display one DCIS lesion with myxoid stroma. This figure illustrates that myxoid DCIS present reduced periductal decorin staining & tend to have increased periductal versican & biglycan expression, whereas sclerotic DCIS generally present strong stromal decorin immunoreactivity, & tend to lack stromal versican & biglycan. Original magnification 100x. Image collected & cropped by CiteAb from the following publication (https://www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Versican Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Multiplex Immunofluorescence
10ug/mL
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Versican
Additional Versican Products
Product Documents for Versican Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Versican Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Versican Antibody - BSA Free
Customer Reviews for Versican Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Versican Antibody - BSA Free and earn rewards!
Have you used Versican Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...