VGLUT2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94571

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all VGLUT2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 500-582 of human VGLUT2 (NP_065079.1). GEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for VGLUT2 Antibody - Azide and BSA Free

Western Blot: VGLUT2 AntibodyAzide and BSA Free [NBP2-94571]

Western Blot: VGLUT2 AntibodyAzide and BSA Free [NBP2-94571]

Western Blot: VGLUT2 Antibody [NBP2-94571] - Analysis of extracts of various cell lines, using VGLUT2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
VGLUT2 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: VGLUT2 Antibody - Azide and BSA Free [NBP2-94571] -

Immunocytochemistry/ Immunofluorescence: VGLUT2 Antibody - Azide and BSA Free [NBP2-94571] - Immunofluorescence analysis of rat brain using VGLUT2 Rabbit pAb (A15177) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
VGLUT2 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: VGLUT2 Antibody - Azide and BSA Free [NBP2-94571] -

Immunocytochemistry/ Immunofluorescence: VGLUT2 Antibody - Azide and BSA Free [NBP2-94571] - Immunofluorescence analysis of mouse brain using VGLUT2 Rabbit pAb (A15177) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for VGLUT2 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: VGLUT2

VGLUT2 is a sodium dependent inorganic phosphate cotransporter that is involved in the calcium dependent glutamate release from astrocytes. It is expressed in only a subset of neurons, localized to synaptic vesicles, at synapses exhibiting classical excitatory features. VGLUT2 mRNA is found in brain regions that lack VGLUT1, a related protein also displaying sodium dependent inorganic phosphate cotransporter activity.

Alternate Names

differentiation-associated BNPI, differentiation-associated Na(+)-dependent inorganic phosphate cotransporter, differentiation-associated Na-dependent inorganic phosphate cotransporter, DNPI, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6, solute carrier family 17 member 6, vesicular glutamate transporter 2, VGLUT2

Gene Symbol

SLC17A6

Additional VGLUT2 Products

Product Documents for VGLUT2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VGLUT2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for VGLUT2 Antibody - Azide and BSA Free

Customer Reviews for VGLUT2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review VGLUT2 Antibody - Azide and BSA Free and earn rewards!

Have you used VGLUT2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies