Wnt-10b Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56449

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Wnt-10b Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Wnt-10b Antibody [NBP2-56449]

Immunocytochemistry/ Immunofluorescence: Wnt-10b Antibody [NBP2-56449]

Immunocytochemistry/Immunofluorescence: Wnt-10b Antibody [NBP2-56449] - Staining of human cell line CACO-2 shows localization to the Golgi apparatus.

Applications for Wnt-10b Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Wnt-10b

Researchers have indicated that they want access to novel target antibodies quickly to aid in their research. Novus is pleased to offer researchers access to products that are not fully characterized or validated. This antibody is shown by Peptide ELISA to bind to the peptide used as immunogen. Investigators should empirically determine the suitability of the antibody, including optimal dilutions, for other applications of interest. * We cannot guarantee that this antibody will work in any application other than in a Peptide ELISA against the peptide used as immunogen and therefore can not offer a refund if the antibody does not work in your application. * The antibody is offered at a lower price compared to more highly validated antibodies. * We are not able to provide the peptide used as immunogen for this product. As this antibody is not fully validated we appreciate your feedback. Customer feedback is used to help generate testing methodologies which can lead to further product validation or withdrawal.__________________________ Wnts comprise a family of secreted signaling proteins that regulate diverse developmental processes. Activation of Wnt signaling by Wnt10b inhibits differentiation of preadipocytes and blocks adipose tissue development. In bone development, Wnt10b shifts cell fate toward the osteoblast lineage.

Long Name

Wingless-type MMTV Integration Site Family, Member 10B

Alternate Names

Wnt-12, Wnt10b

Gene Symbol

WNT10B

Additional Wnt-10b Products

Product Documents for Wnt-10b Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Wnt-10b Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Wnt-10b Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Wnt-10b Antibody - BSA Free and earn rewards!

Have you used Wnt-10b Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies