WWP1 Antibody (1A7) - Azide and BSA Free

Novus Biologicals | Catalog # H00011059-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Primate

Cited:

Human, Primate

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Cited:

Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1A7

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

WWP1 (NP_008944, 152 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT

Reactivity Notes

Primate reactivity reported in scientific literature (PMID: 23573293).

Specificity

WWP1 - WW domain containing E3 ubiquitin protein ligase 1 (1A7)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for WWP1 Antibody (1A7) - Azide and BSA Free

Western Blot: WWP1 Antibody (1A7) [H00011059-M01]

Western Blot: WWP1 Antibody (1A7) [H00011059-M01]

Western Blot: WWP1 Antibody (1A7) [H00011059-M01] - Analysis of WWP1 expression in transfected 293T cell line by WWP1 monoclonal antibody (M01A), clone 1A7.Lane 1: WWP1 transfected lysate(105.2 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: WWP1 Antibody (1A7) [H00011059-M01]

Immunocytochemistry/ Immunofluorescence: WWP1 Antibody (1A7) [H00011059-M01]

Immunocytochemistry/Immunofluorescence: WWP1 Antibody (1A7) [H00011059-M01] - Analysis of monoclonal antibody to WWP1 on A-431 cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: WWP1 Antibody (1A7) [H00011059-M01]

Immunohistochemistry-Paraffin: WWP1 Antibody (1A7) [H00011059-M01]

Immunohistochemistry-Paraffin: WWP1 Antibody (1A7) [H00011059-M01] - Analysis of monoclonal antibody to WWP1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 3 ug/ml.
Western Blot: WWP1 Antibody (1A7) [H00011059-M01]

Western Blot: WWP1 Antibody (1A7) [H00011059-M01]

Western Blot: WWP1 Antibody (1A7) [H00011059-M01] - WWP1 expression in A-431 ( Cat # L015V1 ).
Immunoprecipitation: WWP1 Antibody (1A7) [H00011059-M01]

Immunoprecipitation: WWP1 Antibody (1A7) [H00011059-M01]

Immunoprecipitation: WWP1 Antibody (1A7) [H00011059-M01] - Analysis of WWP1 transfected lysate using anti-WWP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with WWP1 MaxPab rabbit polyclonal antibody.
ELISA: WWP1 Antibody (1A7) [H00011059-M01]

ELISA: WWP1 Antibody (1A7) [H00011059-M01]

ELISA: WWP1 Antibody (1A7) [H00011059-M01] - Detection limit for recombinant GST tagged WWP1 is 0.03 ng/ml as a capture antibody.
WWP1 Antibody (1A7) - Azide and BSA Free

Western Blot: WWP1 Antibody (1A7) - Azide and BSA Free [H00011059-M01] -

High cell density promotes WWP1 stabilization and activation.(A) RPE-1 cells were stably transduced with FLAG-AMOTL2 and either control or WWP1 shRNAs, re-seeded to a sparse or confluent density, then subjected to in vivo ubiquitination assays. (B) mRNAs isolated from MCF10A and 293Ad cells, seeded at either a sparse or confluent density, were analyzed for the indicated genes by qRT-PCR, and expression levels were normalized to those of GAPDH mRNA (n = 4). Data are expressed as means +/- SEM (error bars; ***P < 0.001, n.s. not significant; unpaired t test). (C) MCF10A cells stably transduced with shGFP (control) or shWWP1 lentiviruses were seeded at either a sparse or confluent density and extracts were analyzed by Western blotting. (D) RPE-1 and 293Ad cells were seeded at either a sparse or confluent density, then a cycloheximide (CHX) chase assay was performed for the indicated times. The resulting extracts were analyzed by Western blotting. (E) 293Ad cells were seeded at either sparse or confluent densities and extracts were subjected to S100/P100 membrane-cytosol fractionation assays. The resulting fractions were analyzed for the indicated proteins by Western blotting. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34404733), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WWP1 Antibody (1A7) - Azide and BSA Free

Western Blot: WWP1 Antibody (1A7) - Azide and BSA Free [H00011059-M01] -

High cell density promotes WWP1 stabilization and activation.(A) RPE-1 cells were stably transduced with FLAG-AMOTL2 and either control or WWP1 shRNAs, re-seeded to a sparse or confluent density, then subjected to in vivo ubiquitination assays. (B) mRNAs isolated from MCF10A and 293Ad cells, seeded at either a sparse or confluent density, were analyzed for the indicated genes by qRT-PCR, and expression levels were normalized to those of GAPDH mRNA (n = 4). Data are expressed as means +/- SEM (error bars; ***P < 0.001, n.s. not significant; unpaired t test). (C) MCF10A cells stably transduced with shGFP (control) or shWWP1 lentiviruses were seeded at either a sparse or confluent density and extracts were analyzed by Western blotting. (D) RPE-1 and 293Ad cells were seeded at either a sparse or confluent density, then a cycloheximide (CHX) chase assay was performed for the indicated times. The resulting extracts were analyzed by Western blotting. (E) 293Ad cells were seeded at either sparse or confluent densities and extracts were subjected to S100/P100 membrane-cytosol fractionation assays. The resulting fractions were analyzed for the indicated proteins by Western blotting. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34404733), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WWP1 Antibody (1A7) - Azide and BSA Free

Western Blot: WWP1 Antibody (1A7) - Azide and BSA Free [H00011059-M01] -

High cell density promotes WWP1 stabilization and activation.(A) RPE-1 cells were stably transduced with FLAG-AMOTL2 and either control or WWP1 shRNAs, re-seeded to a sparse or confluent density, then subjected to in vivo ubiquitination assays. (B) mRNAs isolated from MCF10A and 293Ad cells, seeded at either a sparse or confluent density, were analyzed for the indicated genes by qRT-PCR, and expression levels were normalized to those of GAPDH mRNA (n = 4). Data are expressed as means +/- SEM (error bars; ***P < 0.001, n.s. not significant; unpaired t test). (C) MCF10A cells stably transduced with shGFP (control) or shWWP1 lentiviruses were seeded at either a sparse or confluent density and extracts were analyzed by Western blotting. (D) RPE-1 and 293Ad cells were seeded at either a sparse or confluent density, then a cycloheximide (CHX) chase assay was performed for the indicated times. The resulting extracts were analyzed by Western blotting. (E) 293Ad cells were seeded at either sparse or confluent densities and extracts were subjected to S100/P100 membrane-cytosol fractionation assays. The resulting fractions were analyzed for the indicated proteins by Western blotting. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34404733), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WWP1 Antibody (1A7) - Azide and BSA Free

Western Blot: WWP1 Antibody (1A7) - Azide and BSA Free [H00011059-M01] -

High cell density promotes WWP1 stabilization and activation.(A) RPE-1 cells were stably transduced with FLAG-AMOTL2 and either control or WWP1 shRNAs, re-seeded to a sparse or confluent density, then subjected to in vivo ubiquitination assays. (B) mRNAs isolated from MCF10A and 293Ad cells, seeded at either a sparse or confluent density, were analyzed for the indicated genes by qRT-PCR, and expression levels were normalized to those of GAPDH mRNA (n = 4). Data are expressed as means +/- SEM (error bars; ***P < 0.001, n.s. not significant; unpaired t test). (C) MCF10A cells stably transduced with shGFP (control) or shWWP1 lentiviruses were seeded at either a sparse or confluent density and extracts were analyzed by Western blotting. (D) RPE-1 and 293Ad cells were seeded at either a sparse or confluent density, then a cycloheximide (CHX) chase assay was performed for the indicated times. The resulting extracts were analyzed by Western blotting. (E) 293Ad cells were seeded at either sparse or confluent densities and extracts were subjected to S100/P100 membrane-cytosol fractionation assays. The resulting fractions were analyzed for the indicated proteins by Western blotting. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34404733), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WWP1 Antibody (1A7) - Azide and BSA Free

Western Blot: WWP1 Antibody (1A7) - Azide and BSA Free [H00011059-M01] -

WWP1 promotes AMOTL2 phosphorylation by LATS.(A) 293T cells stably transduced with shGFP (control) or shWWP1 lentiviruses were transfected with the indicated DNAs, then lysates were analyzed by Western blotting. (B) 293T cells were transfected with the indicated DNAs, then lysates were analyzed by Western blotting. (C) 293T cells were transfected with the indicated DNAs, then lysates were analyzed by Western blotting. (D) Control or CRISPR/Cas9-mediated LATS1/2-knockout 293T cells were transfected with the indicated DNAs, then lysates were subjected to in vivo ubiquitination assay. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34404733), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for WWP1 Antibody (1A7) - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

10ug/mL

Immunohistochemistry-Paraffin

3ug/mL

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Formulation, Preparation, and Storage

Purification

Ascites

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

This product is unpurified. The exact concentration of antibody is not quantifiable.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: WWP1

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined.

Long Name

WW Domain Containing E3 Ubiquitin Protein Ligase 1

Alternate Names

AIP5, HSDRP1, Tiul11

Gene Symbol

WWP1

OMIM

602307 (Human)

Additional WWP1 Products

Product Documents for WWP1 Antibody (1A7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WWP1 Antibody (1A7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for WWP1 Antibody (1A7) - Azide and BSA Free

Customer Reviews for WWP1 Antibody (1A7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review WWP1 Antibody (1A7) - Azide and BSA Free and earn rewards!

Have you used WWP1 Antibody (1A7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...