Xanthine Oxidase Antibody (0M8E7)

Novus Biologicals | Catalog # NBP3-16735

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0M8E7 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 202-293 of human Xanthine Oxidase (XDH) (P47989). TPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

146 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Xanthine Oxidase Antibody (0M8E7)

Western Blot: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735]

Western Blot: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735]

Western Blot: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Western blot analysis of extracts of various cell lines, using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Xanthine Oxidase Antibody (0M8E7)

Immunocytochemistry/ Immunofluorescence: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] -

Immunocytochemistry/ Immunofluorescence: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Confocal imaging of paraffin-embedded Human liver using Xanthine Oxidase Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Xanthine Oxidase Antibody (0M8E7)

Immunocytochemistry/ Immunofluorescence: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] -

Immunocytochemistry/ Immunofluorescence: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Confocal imaging of NIH/3T3 cells using Xanthine Oxidase Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Xanthine Oxidase Antibody (0M8E7)

Immunohistochemistry: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] -

Immunohistochemistry: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using Xanthine Oxidase Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Xanthine Oxidase Antibody (0M8E7)

Immunohistochemistry: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] -

Immunohistochemistry: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Xanthine Oxidase Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Xanthine Oxidase Antibody (0M8E7)

Immunohistochemistry: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] -

Immunohistochemistry: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Xanthine Oxidase Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Xanthine Oxidase Antibody (0M8E7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:200 - 1:400

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Xanthine Oxidase

Xanthine dehydrogenase belongs to the group of molybdenum-containing hydroxylases involved in the oxidative metabolism of purines. The enzyme is a homodimer. Xanthine dehydrogenase can be converted to xanthine oxidase by reversible sulfhydryl oxidation or by irreversible proteolytic modification. Defects in xanthine dehydrogenase cause xanthinuria, may contribute to adult respiratory stress syndrome, and may potentiate influenza infection through an oxygen metabolite-dependent mechanism. (provided by RefSeq)

Long Name

Xanthine dehydrogenase/oxidase [Includes: Xanthine dehydrogenase

Alternate Names

EC 1.17.3.2, XD, XDH, XDHA, XOR)

Gene Symbol

XDH

Additional Xanthine Oxidase Products

Product Documents for Xanthine Oxidase Antibody (0M8E7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Xanthine Oxidase Antibody (0M8E7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Xanthine Oxidase Antibody (0M8E7)

There are currently no reviews for this product. Be the first to review Xanthine Oxidase Antibody (0M8E7) and earn rewards!

Have you used Xanthine Oxidase Antibody (0M8E7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...