XE7 Antibody (2G8) - Azide and BSA Free
Novus Biologicals | Catalog # H00008227-M02
![Western Blot: XE7 Antibody (2G8) [H00008227-M02]](https://resources.rndsystems.com/images/products/XE7-Antibody-2G8-Western-Blot-H00008227-M02-img0010.jpg "Western Blot: XE7 Antibody (2G8) [H00008227-M02]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2b Kappa Clone # 2G8
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
SFRS17A (NP_005079, 53 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC
Specificity
RP13-297E16.1 - DNA segment on chromosome X and Y (unique) 155 expressed sequence, isoform 1
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2b Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for XE7 Antibody (2G8) - Azide and BSA Free
Western Blot: XE7 Antibody (2G8) [H00008227-M02]
Western Blot: XE7 Antibody (2G8) [H00008227-M02] - SFRS17A monoclonal antibody (M02), clone 2G8 Analysis of SFRS17A expression in Hela S3 NE.![Immunocytochemistry/ Immunofluorescence: XE7 Antibody (2G8) [H00008227-M02]](https://resources.rndsystems.com/images/products/XE7-Antibody-2G8-Immunocytochemistry-Immunofluorescence-H00008227-M02-img0006.jpg "Immunocytochemistry/ Immunofluorescence: XE7 Antibody (2G8) [H00008227-M02]")
Immunocytochemistry/ Immunofluorescence: XE7 Antibody (2G8) [H00008227-M02]
Immunocytochemistry/Immunofluorescence: XE7 Antibody (2G8) [H00008227-M02] - Analysis of monoclonal antibody to SFRS17A on HeLa cell. Antibody concentration 10 ug/ml.![Immunohistochemistry-Paraffin: XE7 Antibody (2G8) [H00008227-M02]](https://resources.rndsystems.com/images/products/XE7-Antibody-2G8-Immunohistochemistry-Paraffin-H00008227-M02-img0008.jpg "Immunohistochemistry-Paraffin: XE7 Antibody (2G8) [H00008227-M02]")
Immunohistochemistry-Paraffin: XE7 Antibody (2G8) [H00008227-M02]
Immunohistochemistry-Paraffin: XE7 Antibody (2G8) [H00008227-M02] - Analysis of monoclonal antibody to SFRS17A on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1 ug/ml.![Western Blot: XE7 Antibody (2G8) [H00008227-M02]](https://resources.rndsystems.com/images/products/XE7-Antibody-2G8-Western-Blot-H00008227-M02-img0011.jpg "Western Blot: XE7 Antibody (2G8) [H00008227-M02]")
Western Blot: XE7 Antibody (2G8) [H00008227-M02]
Western Blot: XE7 Antibody (2G8) [H00008227-M02] - Analysis of SFRS17A expression in transfected 293T cell line by SFRS17A monoclonal antibody (M02), clone 2G8.Lane 1: SFRS17A transfected lysate(51.5 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: XE7 Antibody (2G8) [H00008227-M02] - Detection limit for recombinant GST tagged SFRS17A is approximately 0.1ng/ml as a capture antibody.
Applications for XE7 Antibody (2G8) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Paraffin
Optimal dilutions of this antibody should be experimentally determined.
Sandwich ELISA
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: XE7
Alternate Names
A kinase (PRKA) anchor protein 17A, AKAP-17A, A-kinase anchor protein 17A, B-lymphocyte antigen, B-lymphocyte surface antigen, CCDC133, CXYorf3, DXYS155EPRKA17A, MGC39904, Protein kinase A-anchoring protein 17A, Protein XE7, pseudoautosomal gene XE7, SFRS17AMGC125366, Splicing factor, arginine/serine-rich 17AFLJ98315,721PMGC125365, XE7chromosome X and Y open reading frame 3, XE7Y
Entrez Gene IDs
8227 (Human)
Gene Symbol
AKAP17A
OMIM
312095 (Human)
UniProt
Additional XE7 Products
Product Documents for XE7 Antibody (2G8) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for XE7 Antibody (2G8) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for XE7 Antibody (2G8) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review XE7 Antibody (2G8) - Azide and BSA Free and earn rewards!
Have you used XE7 Antibody (2G8) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...