Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human, Mouse
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: RPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVK
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%). Mouse reactivity reported from a verified customer review.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ZC3H14 Antibody - BSA Free
Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537]
Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human colon, kidney, liver and testis using Anti-ZC3H14 antibody NBP2-13537 (A) shows similar protein distribution across tissues to independent antibody NBP2-49087 (B).Western Blot: ZC3H14 Antibody [NBP2-13537]
Western Blot: ZC3H14 Antibody [NBP2-13537] - Analysis in human cell line RH-30.Immunocytochemistry/ Immunofluorescence: ZC3H14 Antibody [NBP2-13537]
Immunocytochemistry/Immunofluorescence: ZC3H14 Antibody [NBP2-13537] - Staining of human cell line MCF7 shows localization to nuclear speckles. Antibody staining is shown in green.Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537]
Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human colon shows strong nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537]
Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.Immunohistochemistry: ZC3H14 Antibody - BSA Free [NBP2-13537]
Staining of human colon shows strong nuclear positivity in glandular cells.Immunohistochemistry: ZC3H14 Antibody - BSA Free [NBP2-13537]
Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.Immunohistochemistry: ZC3H14 Antibody - BSA Free [NBP2-13537]
Staining of human colon).Western Blot: ZC3H14 Antibody - BSA Free [NBP2-13537]
Analysis in human cell line RH-30.Immunohistochemistry: ZC3H14 Antibody - BSA Free [NBP2-13537]
Staining of human kidney shows moderate nuclear positivity in cells in tubules.Immunohistochemistry: ZC3H14 Antibody - BSA Free [NBP2-13537]
Staining of human liver shows no nuclear positivity in hepatocytes as expected.Applications for ZC3H14 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 5 using NBP2-13537 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ZC3H14
Alternate Names
FLJ11806, Mammalian suppressor of tau pathology-2, MGC26892, MSUT-2, nuclear protein UKp68, NY-REN-37, Renal carcinoma antigen NY-REN-37, SUT2, UKp68, zinc finger CCCH domain-containing protein 14, zinc finger CCCH-type containing 14
Gene Symbol
ZC3H14
Additional ZC3H14 Products
Product Documents for ZC3H14 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ZC3H14 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ZC3H14 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used ZC3H14 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Whole cell lysate neuronal cellsSpecies: MouseVerified Customer | Posted 06/12/2018100 ug of Ht22 cell lysate was loaded. Ab was added to blot at 1:500 for 1 hour at room temperature. LiCor secondary (Donkey anti rabbit) at 1:15000 for 1 hour at room temperature.This product was not tested for mouse on the website. Looking forward for a refund for the full amount if review is approved.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...