Integrin alpha V/CD51 Antibody (10T9N2)
Novus Biologicals | Catalog # NBP3-15647
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 10T9N2 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human Integrin alpha V/CD51 (NP_002201.2). SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
116 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Integrin alpha V/CD51 Antibody (10T9N2)
Western Blot: Integrin alpha V/CD51 Antibody (10T9N2) [NBP3-15647]
Western Blot: Integrin alpha V/CD51 Antibody (7O8N2) [NBP3-15647] - Analysis of extracts of various cell lines, using Integrin alpha V/CD51 (ITGAV/CD51) antibody (NBP3-15647) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.ICC/IF: Integrin alpha V/CD51 Antibody (7O8N2) [NBP3-15647] -
ICC/IF: Integrin alpha V/CD51 Antibody (7O8N2) [NBP3-15647] -ITGAV Antibody [NBP3-15647] was used (1:100) for labeling and microscopy analysis of the distribution of ITGAV proteins in SUM159 cells. Validated customer review.Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] -
Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Integrin alpha V/CD51 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] -
Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Integrin alpha V/CD51 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] -
Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Integrin alpha V/CD51 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Applications for Integrin alpha V/CD51 Antibody (10T9N2)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL
Immunocytochemistry/ Immunofluorescence
Validated from a verified customer review
Immunohistochemistry
1:50 - 1:200
Western Blot
1:1000 - 1:6000
Reviewed Applications
Read 2 reviews rated 4.5 using NBP3-15647 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Integrin alpha V/CD51
Alternate Names
CD51, ITGAV, MSK8, Vitronectin Receptor alpha, VNRA
Gene Symbol
ITGAV
Additional Integrin alpha V/CD51 Products
Product Documents for Integrin alpha V/CD51 Antibody (10T9N2)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Integrin alpha V/CD51 Antibody (10T9N2)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Integrin alpha V/CD51 Antibody (10T9N2) (2)
4.5 out of 5
2 Customer Ratings
Have you used Integrin alpha V/CD51 Antibody (10T9N2)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
2 的
2 reviews
Showing All
Filter By:
-
Application: ImmunocytochemistrySample Tested: SUM159Species: HumanVerified Customer | Posted 12/01/2022Immunofluorescence (IF): ITGAV Antibody [NBP3-15647] was used (1:100) for labeling and microscopy analysis of the distribution of ITGAV proteins in SUM159 cells.
-
Application: Western BlotSample Tested: MDA-MB-231 Cell Lysate and SUM-159PT human breast cancer cell lineSpecies: HumanVerified Customer | Posted 10/20/2022Western Blot: whole cell lysates from MDA-MB-231 or SUM159PT cells was loaded with 50 ug/lane. 10% SDS-PAGE. ITGAV Antibody (NBP3-15647) was used for primary antibody: 1:2000, 4℃, overnight.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars