NCAM-1/CD56 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38452

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Predicted:

Mouse (93%), Rat (94%). Backed by our 100% Guarantee.

Applications

Validated:

Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NCAM-1/CD56 Antibody - BSA Free

Western Blot: NCAM-1/CD56 Antibody [NBP2-38452]

Western Blot: NCAM-1/CD56 Antibody [NBP2-38452]

Western Blot: NCAM-1/CD56 Antibody [NBP2-38452] - Analysis in human brain tissue.
Immunocytochemistry/ Immunofluorescence: NCAM-1/CD56 Antibody [NBP2-38452]

Immunocytochemistry/ Immunofluorescence: NCAM-1/CD56 Antibody [NBP2-38452]

Immunocytochemistry/Immunofluorescence: NCAM-1/CD56 Antibody [NBP2-38452] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
NCAM-1/CD56 Antibody - BSA Free

Western Blot: NCAM-1/CD56 Antibody - BSA Free [NBP2-38452] -

CSF EVs isolated by SEC are enriched for exosome and MV markers. (A) Equal volume loading of protein lysate (37 uL) from pools of SEC Fractions (Fxs): 1–5 (column void volume), 6–9, 10–13, and 14–17 stained for total protein, and immunoblotted for albumin, APOA1, and APOE. (B) Equal concentration loading of protein lysate (0.1 ug) from pools of Fxs 1–5, 6–9, 10–13, and 14–17 immunoblotted for CD9, CD63, CD81, flotillin, TSG101, AnnV, SYP, NCAM-1, GLAST, CD11b, and TMEM119. (C) Equal concentration loading of (1 ug) from pools of Fxs 1–5, 6–9, 10–13, and 14–17 immunoblotted for SYP and CD11b. Postmortem human cerebral cortex protein lysate (0.1 ug and 1 ug) was run as a positive control for each gel ((A-C): Brain). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35573689), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NCAM-1/CD56 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NCAM-1/CD56

NCAM, as a member of the immunoglobulin superfamily of adhesion molecules is characterized by several immunoglobulin (Ig) like domains. The extracellular part of NCAM consists of five of these Ig domains and two fibronectin type III homology regions. NCAM is encoded by a single copy gene composed of 26 exons. However, at least 20-30 distinct isoforms can be generated by alternative splicing and by posttranslational modifications, such as sialylation. During sialylation, polysialic acid (PSA) carbohydrates are attached to the extracellular part of NCAM. Through its extracellular region, NCAM mediates homophilic interactions. In addition, NCAM can also undergo heterophilic interactions by binding extracellular matrix components, such as laminin, or other cell adhesion molecules, such as integrins. NCAM is expressed on most neuroectodermal derived cell lines, tissues and neoplasm such as retinoblastoma, medulloblastoma, astrocytomas and neuroblastoma.

Long Name

Neural Cell Adhesion Molecule

Alternate Names

CD56, NCAM1

Gene Symbol

NCAM1

Additional NCAM-1/CD56 Products

Product Documents for NCAM-1/CD56 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NCAM-1/CD56 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NCAM-1/CD56 Antibody - BSA Free

Customer Reviews for NCAM-1/CD56 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NCAM-1/CD56 Antibody - BSA Free and earn rewards!

Have you used NCAM-1/CD56 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies