AMPK beta 1 Antibody (7G8U1)

Novus Biologicals | Catalog # NBP3-16380

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7G8U1 expressed in HEK293
View all AMPK beta 1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human AMPK beta 1 (Q9Y478). EEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AMPK beta 1 Antibody (7G8U1)

Western Blot: AMPK beta 1 Antibody (7G8U1) [NBP3-16380]

Western Blot: AMPK beta 1 Antibody (7G8U1) [NBP3-16380]

Western Blot: AMPK beta 1 Antibody (7G8U1) [NBP3-16380] - Western blot analysis of extracts of various cell lines, using AMPK beta 1 Rabbit mAb (NBP3-16380) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody (7G8U1) [NBP3-16380]

Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody (7G8U1) [NBP3-16380]

Immunocytochemistry/Immunofluorescence: AMPK beta 1 Antibody (7G8U1) [NBP3-16380] - Immunofluorescence analysis of NIH-3T3 cells using AMPK beta 1 Rabbit mAb (NBP3-16380) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: AMPK beta 1 Antibody (7G8U1) [NBP3-16380]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody (7G8U1) [NBP3-16380]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody (7G8U1) [NBP3-16380] - Immunohistochemistry of paraffin-embedded human colon using AMPK beta 1 Rabbit mAb (NBP3-16380) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Western Blot: AMPK beta 1 Antibody (7G8U1) [NBP3-16380]

Western Blot: AMPK beta 1 Antibody (7G8U1) [NBP3-16380]

Western Blot: AMPK beta 1 Antibody (7G8U1) [NBP3-16380] - Western blot analysis of extracts of Mouse brain, using AMPK beta 1 Rabbit mAb (NBP3-16380) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: AMPK beta 1 Antibody (7G8U1) [NBP3-16380]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody (7G8U1) [NBP3-16380]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody (7G8U1) [NBP3-16380] - Immunohistochemistry of paraffin-embedded rat ovary using AMPK beta 1 Rabbit mAb (NBP3-16380) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
AMPK beta 1 Antibody (7G8U1)

Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody (7G8U1) [NBP3-16380] -

Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody (7G8U1) [NBP3-16380] - Confocal imaging of MCF7 cells using AMPK beta 1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
AMPK beta 1 Antibody (7G8U1)

Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody (7G8U1) [NBP3-16380] -

Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody (7G8U1) [NBP3-16380] - Confocal imaging of NIH/3T3 cells using AMPK beta 1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Applications for AMPK beta 1 Antibody (7G8U1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AMPK beta 1

The 5'-AMP-activated protein kinase (AMPK), a member of the SNF1 (sucrose non-fermentor) kinase family (1). AMPK is a heterotrimeric protein comprising alpha (63 kDa), beta (38 kDa) and gamma (38 kDa) subunits (2). The alpha subunit is the catalytic subunit, while beta and gamma are non-catalytic subunits, although they have been found to interact with the active subunit in liver. AMPK regulates fatty acid and sterol synthesis by phosphorylation of acetyl-CoA as well as cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase (3). AMPK beta-1 mediates the association of the AMPK heterotrimeric complex in vitro (2). Two isoforms have been found and the difference in expression patterns indicates tissue-specific roles for these isoforms (4).

Long Name

AMP-activated Protein Kinase beta 1

Alternate Names

PRKAB1

Gene Symbol

PRKAB1

Additional AMPK beta 1 Products

Product Documents for AMPK beta 1 Antibody (7G8U1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AMPK beta 1 Antibody (7G8U1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Autophagy
Intracellular Kinases
Obesity

Customer Reviews for AMPK beta 1 Antibody (7G8U1)

There are currently no reviews for this product. Be the first to review AMPK beta 1 Antibody (7G8U1) and earn rewards!

Have you used AMPK beta 1 Antibody (7G8U1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies