AMPK beta 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87487

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AMPK beta 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AMPK beta 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487] - Staining in human kidney and skeletal muscle tissues.. Corresponding PRKAB1 RNA-seq data are presented for the same tissues.
Western Blot: AMPK beta 1 Antibody [NBP1-87487]

Western Blot: AMPK beta 1 Antibody [NBP1-87487]

Western Blot: AMPK beta 1 Antibody [NBP1-87487] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody [NBP1-87487]

Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody [NBP1-87487]

Immunocytochemistry/Immunofluorescence: AMPK beta 1 Antibody [NBP1-87487] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol. Antibody staining is shown in green.
Western Blot: AMPK beta 1 Antibody [NBP1-87487]

Western Blot: AMPK beta 1 Antibody [NBP1-87487]

Western Blot: AMPK beta 1 Antibody [NBP1-87487] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487]

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Applications for AMPK beta 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AMPK beta 1

The 5'-AMP-activated protein kinase (AMPK), a member of the SNF1 (sucrose non-fermentor) kinase family (1). AMPK is a heterotrimeric protein comprising alpha (63 kDa), beta (38 kDa) and gamma (38 kDa) subunits (2). The alpha subunit is the catalytic subunit, while beta and gamma are non-catalytic subunits, although they have been found to interact with the active subunit in liver. AMPK regulates fatty acid and sterol synthesis by phosphorylation of acetyl-CoA as well as cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase (3). AMPK beta-1 mediates the association of the AMPK heterotrimeric complex in vitro (2). Two isoforms have been found and the difference in expression patterns indicates tissue-specific roles for these isoforms (4).

Long Name

AMP-activated Protein Kinase beta 1

Alternate Names

PRKAB1

Gene Symbol

PRKAB1

Additional AMPK beta 1 Products

Product Documents for AMPK beta 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AMPK beta 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Autophagy
Intracellular Kinases
Obesity

Citations for AMPK beta 1 Antibody - BSA Free

Customer Reviews for AMPK beta 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AMPK beta 1 Antibody - BSA Free and earn rewards!

Have you used AMPK beta 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies