Apolipoprotein A-IV/ApoA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86179

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Apolipoprotein A-IV/ApoA4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179]

Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179]

Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179] - Analysis in human small intestine and liver tissues. Corresponding APOA4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179]

Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179]

Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179]

Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179]

Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179]

Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179]

Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179]

Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179]

Immunohistochemistry-Paraffin: Apolipoprotein A-IV/ApoA4 Antibody [NBP1-86179] - Staining of human colon shows no positivity in glandular cells as expected.
Apolipoprotein A-IV/ApoA4 Antibody - BSA Free Western Blot: Apolipoprotein A-IV/ApoA4 Antibody - BSA Free [NBP1-86179]

Western Blot: Apolipoprotein A-IV/ApoA4 Antibody - BSA Free [NBP1-86179]

Analysis in control (vector only transfected HEK293T lysate) and APOA4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for Apolipoprotein A-IV/ApoA4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Apolipoprotein A-IV/ApoA4

Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.

Alternate Names

Apolipoprotein AIV

Gene Symbol

APOA4

Additional Apolipoprotein A-IV/ApoA4 Products

Product Documents for Apolipoprotein A-IV/ApoA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Apolipoprotein A-IV/ApoA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Apolipoprotein A-IV/ApoA4 Antibody - BSA Free

Customer Reviews for Apolipoprotein A-IV/ApoA4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Apolipoprotein A-IV/ApoA4 Antibody - BSA Free and earn rewards!

Have you used Apolipoprotein A-IV/ApoA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Apolipoprotein A-IV/ApoA4 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I would like to buy antibodies APOA4 (apolipoprotein AIV) for the cows (to western blot). I know that You don't have the antibodies for this species. Could You propose the best atibodies which I could test (use) in my experiment?

    A:

    All eight of our APOA4 antibodies were raised against the human protein, and all of them have currently only been tested against human samples. I ran an alignment for you and found that there is a 77% sequence homology between human and bovine APOA4, so it is possible that the antibodies raised against human APOA4 may recognise the bovine protein. Should you wish to try any of our antibodies with your samples, you may be interested in our Innovator's Reward Program, which allows you to try our primary antibodies in an untested species or application without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...