Calpain S1 Antibody (3C4) - Azide and BSA Free

Novus Biologicals | Catalog # H00000826-M01

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 3C4

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Calpain S1 (AAH00592, 172 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Calpain S1 Antibody (3C4) - Azide and BSA Free

Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01]

Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01]

Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01] - Analysis of Calpain S1 expression in transfected 293T cell line by Calpain S1 monoclonal antibody (M01), clone 3C4.Lane 1: Calpain S1 transfected lysate(28.3 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: Calpain S1 Antibody (3C4) [H00000826-M01]

Immunocytochemistry/ Immunofluorescence: Calpain S1 Antibody (3C4) [H00000826-M01]

Immunocytochemistry/Immunofluorescence: Calpain S1 Antibody (3C4) [H00000826-M01] - Analysis of monoclonal antibody to Calpain S1 on HeLa cell. Antibody concentration 20 ug/ml.
Immunohistochemistry-Paraffin: Calpain S1 Antibody (3C4) [H00000826-M01]

Immunohistochemistry-Paraffin: Calpain S1 Antibody (3C4) [H00000826-M01]

Immunohistochemistry-Paraffin: Calpain S1 Antibody (3C4) [H00000826-M01] - Analysis of monoclonal antibody to Calpain S1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01]

Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01]

Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01] - Analysis of Calpain S1 over-expressed 293 cell line, cotransfected with Calpain S1 Validated Chimera RNAi ( Cat # H00000826-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with Calpain S1 monoclonal antibody (M01), clone 3C4 (Cat # H00000826-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01]

Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01]

Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01] - Calpain S1 monoclonal antibody (M01), clone 3C4. Analysis of Calpain S1 expression in PC-12.
Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01]

Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01]

Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01] - Calpain S1 monoclonal antibody (M01), clone 3C4 Analysis of Calpain S1 expression in A-431.
Sandwich ELISA: Calpain S1 Antibody (3C4) [H00000826-M01] - Detection limit for recombinant GST tagged Calpain S1 is approximately 0.1ng/ml as a capture antibody.

Applications for Calpain S1 Antibody (3C4) - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:500

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Sandwich ELISA

1:100-1:2000

Western Blot

1:500
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Calpain S1

This gene is a member of the calpain small subunit family. Calpains are calcium-dependent cysteine proteinases that are widely distributed in mammalian cells. Calpains operate as heterodimers, comprising a specific large catalytic subunit (calpain 1 subunit in Calpain I, and calpain 2 subunit in Calpain II), and a common small regulatory subunit encoded by this gene. This encoded protein is essential for the stability and function of both calpain heterodimers, whose proteolytic activities influence various cellular functions including apoptosis, proliferation, migration, adhesion, and autophagy. Calpains have been implicated in neurodegenerative processes, such as myotonic dystrophy. A pseudogene of this gene has been defined on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Alternate Names

Calcium-activated neutral proteinase small subunit, Calcium-dependent protease small subunit 1, calcium-dependent protease, small subunit, calpain 4, small subunit (30K), Calpain regulatory subunit, calpain small subunit 1, calpain, small polypeptide, CALPAIN4, CANP, CANPS, CAPN4, CDPS, CSS1, epididymis secretory sperm binding protein

Entrez Gene IDs

826 (Human)

Gene Symbol

CAPNS1

OMIM

114170 (Human)

Additional Calpain S1 Products

Product Documents for Calpain S1 Antibody (3C4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Calpain S1 Antibody (3C4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Calpain S1 Antibody (3C4) - Azide and BSA Free

Customer Reviews for Calpain S1 Antibody (3C4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Calpain S1 Antibody (3C4) - Azide and BSA Free and earn rewards!

Have you used Calpain S1 Antibody (3C4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...