CaM Kinase II gamma Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37964

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CaM Kinase II gamma Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human CaM Kinase II gamma (NP_751909.1).

Sequence:
LKGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CaM Kinase II gamma Antibody - BSA Free

CaM Kinase II gamma Antibody

Immunohistochemistry: CaM Kinase II gamma Antibody [NBP3-37964] -

Immunohistochemistry: CaM Kinase II gamma Antibody [NBP3-37964] - Immunohistochemistry analysis of paraffin-embedded Rat heart using CaM Kinase II gamma Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CaM Kinase II gamma Antibody

Immunohistochemistry: CaM Kinase II gamma Antibody [NBP3-37964] -

Immunohistochemistry: CaM Kinase II gamma Antibody [NBP3-37964] - Immunohistochemistry analysis of paraffin-embedded Human stomach using CaM Kinase II gamma Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CaM Kinase II gamma Antibody

Western Blot: CaM Kinase II gamma Antibody [NBP3-37964] -

Western Blot: CaM Kinase II gamma Antibody [NBP3-37964] - Western blot analysis of various lysates using CaM Kinase II gamma Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
CaM Kinase II gamma Antibody

Immunohistochemistry: CaM Kinase II gamma Antibody [NBP3-37964] -

Immunohistochemistry: CaM Kinase II gamma Antibody [NBP3-37964] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using CaM Kinase II gamma Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CaM Kinase II gamma Antibody

Immunocytochemistry/ Immunofluorescence: CaM Kinase II gamma Antibody [NBP3-37964] -

Immunocytochemistry/ Immunofluorescence: CaM Kinase II gamma Antibody [NBP3-37964] - Immunofluorescence analysis of paraffin-embedded Mouse brain using CaM Kinase II gamma Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CaM Kinase II gamma Antibody

Immunocytochemistry/ Immunofluorescence: CaM Kinase II gamma Antibody [NBP3-37964] -

Immunocytochemistry/ Immunofluorescence: CaM Kinase II gamma Antibody [NBP3-37964] - Immunofluorescence analysis of paraffin-embedded Rat brain using CaM Kinase II gamma Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for CaM Kinase II gamma Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CaM Kinase II gamma

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Six alternatively spliced variants that encode six different isoforms have been characterized to date. Additional alternative splice variants that encode different isoforms have been described, but their full-length nature has not been determined.

Long Name

Calcium/calmodulin-dependent Protein Kinase II gamma Subunit

Alternate Names

CAMK2G, CAMKG

Gene Symbol

CAMK2G

Additional CaM Kinase II gamma Products

Product Documents for CaM Kinase II gamma Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CaM Kinase II gamma Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CaM Kinase II gamma Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CaM Kinase II gamma Antibody - BSA Free and earn rewards!

Have you used CaM Kinase II gamma Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies