CD133 Antibody (3Y4A5)

Novus Biologicals | Catalog # NBP3-15310

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3Y4A5 expressed in HEK293
View all CD133 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 250-380 of human CD133 (O43490). IPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD133 Antibody (3Y4A5)

Western Blot: CD133 Antibody (3Y4A5) [NBP3-15310]

Western Blot: CD133 Antibody (3Y4A5) [NBP3-15310]

Western Blot: CD133 Antibody (3Y4A5) [NBP3-15310] - Western blot analysis of extracts of HT-29 cells, using CD133 antibody (NBP3-15310) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
CD133 Antibody (3Y4A5)

Detection of Human CD133 by Simple WesternTM.Dilution: 12-60 µg/mL

Left: Simple Western lane view shows lysates of HT‑29 human colon adenocarcinoma cell line, loaded at 0.1 mg/ml. A specific band was detected for CD133 at approximately 166 kDa (as indicated) using both 12 µg/ml and 60 µg/ml of Rabbit Anti-Human CD133 Monoclonal Antibody (Catalog # NBP3-15310) followed by HRP-conjugated Goat Anti-Rabbit Secondary Antibody (Catalog # 042-206). This experiment was conducted under reducing conditions and using the 12-230kDa separation system. Right: Simple Western electropherogram showing the same Rabbit Anti-Human CD133 Monoclonal Antibody (Catalog # NBP3-15310) tested at 12 µg/ml (blue line) and 60 µg/ml (green line) in the HT‑29 human colon adenocarcinoma cell line.
Immunohistochemistry-Paraffin: CD133 Antibody (3Y4A5) [NBP3-15310]

Immunohistochemistry-Paraffin: CD133 Antibody (3Y4A5) [NBP3-15310]

Immunohistochemistry-Paraffin: CD133 Antibody (3Y4A5) [NBP3-15310] - Immunohistochemistry of paraffin-embedded human colon carcinoma using CD133 Rabbit mAb (NBP3-15310) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Knockout Validated: CD133 Antibody (3Y4A5) [NBP3-15310]

Western Blot: CD133 Antibody (3Y4A5) [NBP3-15310]

Western Blot: CD133 Antibody (3Y4A5) [NBP3-15310] - Western blot analysis of extracts from normal (control) and CD133 knockout (KO) HCT116 cells, using CD133 antibody (NBP3-15310) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
CD133 Antibody (3Y4A5)

Western Blot: CD133 Antibody (3Y4A5) [CD133] -

Western Blot: CD133 Antibody (3Y4A5) [CD133] - Western blot analysis of lysates from HT-29 cells, using CD133 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
CD133 Antibody (3Y4A5)

Immunohistochemistry: CD133 Antibody (3Y4A5) [CD133] -

Immunohistochemistry: CD133 Antibody (3Y4A5) [CD133] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using CD133 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CD133 Antibody (3Y4A5)

Immunohistochemistry: CD133 Antibody (3Y4A5) [CD133] -

Immunohistochemistry: CD133 Antibody (3Y4A5) [CD133] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using CD133 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for CD133 Antibody (3Y4A5)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Simple Western

12-60 µg/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CD133

Prominin 1 (CD133) is expressed on primitive hematopoietic stem and progenitor cells, retinoblastoma, hemangioblasts, and neural stem cells as well as on developing epithelium. The CD133 positive fraction of human bone marrow, cord blood and peripheral blood have been shown to efficiently engraft in xenotransplantation models, and have been shown to contain the majority of the granulocyte/macrophage precursors, NOD/SCID repopulating cells and CD34 + dendritic cell precursors.

Alternate Names

AC133, CD133, PROM1, Prominin 1, PROML1

Gene Symbol

PROM1

Additional CD133 Products

Product Documents for CD133 Antibody (3Y4A5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CD133 Antibody (3Y4A5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD133 Antibody (3Y4A5)

There are currently no reviews for this product. Be the first to review CD133 Antibody (3Y4A5) and earn rewards!

Have you used CD133 Antibody (3Y4A5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies