CD34 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38322

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Predicted:

Mouse (95%), Rat (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CD34 Antibody - BSA Free (NBP2-38322) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CD34 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CD34 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322]

Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322]

Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322] - Analysis in human placenta and cerebral cortex tissues. Corresponding CD34 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: CD34 Antibody [NBP2-38322]

Immunocytochemistry/ Immunofluorescence: CD34 Antibody [NBP2-38322]

Immunocytochemistry/Immunofluorescence: CD34 Antibody [NBP2-38322] - Staining of human cell line HUVEC TERT2 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322]

Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322]

Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322] - Staining of human kidney shows moderate membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322]

Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322]

Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322] - Staining of human placenta shows moderate to strong membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322]

Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322]

Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322] - Staining of human tonsil shows moderate to strong membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322]

Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322]

Immunohistochemistry-Paraffin: CD34 Antibody [NBP2-38322] - Staining of human cerebral cortex shows moderate membranous positivity in endothelial cells and very weak cytoplasmic positivity in neurons.

Applications for CD34 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD34

CD34, also known as Cluster of Differentiation 34, is a transmembrane phosphoglycoprotein that is primarily known for being a surface marker for hematopoietic stem cells (HSCs) and progenitor cells (1,2). The CD34 protein consists of a heavily glycosylated extracellular domain, a single-pass transmembrane helix, and a cytoplasmic tail with PDZ binding motifs (1,3). Human CD34 has two protein isoforms consisting of 385 amino acids (aa) for the canonical isoform and 328 aa for isoform 2 (3,4). The canonical CD34 isoform has calculated theoretical molecular weight of 40 kDa and an observed molecular weight of ~115 kDa (1,3,4). L-Selectin (CD62L) is the most common ligand for CD34, but it has also been shown to bind CrkL (1,3).

CD34 has commonly been used as a marker for the diagnosis and classification of various diseases and pathologies including leukemia and solitary fibrous tumor (SFT) (2,5). In terms of immunohistochemistry and histopathology, CD34 has been the most common marker for SFT and is expressed in ~79% of cases (5). In addition to its use as a cell marker, CD34-postive (CD34+) hematopoietic stem cells have been used therapeutically in patients following radiation or chemotherapy due to their regenerative potential (6). There are several clinical trials showing promising results for CD34+ cell therapy for cardiovascular diseases including heart failure, ischemia, dilated cardiomyopathy, acute myocardial infarction, and angina (6). Besides hematopoietic lineages, CD34 is also expressed in non-hematopoietic cells including mesenchymal stem cells, endothelial cells and progenitors, fibrocytes, muscle satellite cells, and some cancer stem cells (1,3). While the clinical and cell therapy applications of CD34 as a cell marker is well documented, the function of CD34 is less understood but has been implicated in many cellular processes such as adhesion, proliferation, signal transduction, differentiation, and progenitor phenotype maintenance (1,3).

References

1. Sidney, L. E., Branch, M. J., Dunphy, S. E., Dua, H. S., & Hopkinson, A. (2014). Concise review: evidence for CD34 as a common marker for diverse progenitors. Stem cells (Dayton, Ohio), 32(6), 1380-1389. https://doi.org/10.1002/stem.1661

2. Krause, D. S., Fackler, M. J., Civin, C. I., & May, W. S. (1996). CD34: structure, biology, and clinical utility. Blood, 87(1), 1-13

3. Kapoor, S., Shenoy, S. P., & Bose, B. (2020). CD34 cells in somatic, regenerative and cancer stem cells: Developmental biology, cell therapy, and omics big data perspective. Journal of cellular biochemistry, 121(5-6), 3058-3069. https://doi.org/10.1002/jcb.29571

4. Uniprot (P28906)

5. Davanzo, B., Emerson, R. E., Lisy, M., Koniaris, L. G., & Kays, J. K. (2018). Solitary fibrous tumor. Translational gastroenterology and hepatology, 3, 94. https://doi.org/10.21037/tgh.2018.11.02

6. Prasad, M., Corban, M. T., Henry, T. D., Dietz, A. B., Lerman, L. O., & Lerman, A. (2020). Promise of autologous CD34+ stem/progenitor cell therapy for treatment of cardiovascular disease. Cardiovascular research, 116(8), 1424-1433. https://doi.org/10.1093/cvr/cvaa027

Alternate Names

CD34, HPCA1

Gene Symbol

CD34

UniProt

Additional CD34 Products

Product Documents for CD34 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD34 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CD34 Antibody - BSA Free

Customer Reviews for CD34 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD34 Antibody - BSA Free and earn rewards!

Have you used CD34 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD34 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I wonder if you have a CD105 or CD34 antibody suitable for IHC that is specific for human and do not bind mouse?

    A: We do not have any anti-human CD34 or CD105 antibodies that are confirmed to NOT detect the mouse protein. When we have tested an antibody and confirmed that it will not react with mouse samples, we will add Mu(-) to the datasheet, and unfortunately all of our CD105 and CD34 antibodies will either detect the mouse protein, or they have not been used in mouse samples before.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies