CHCHD2 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP2-92335
![Western Blot: CHCHD2 AntibodyAzide and BSA Free [NBP2-92335]](https://resources.rndsystems.com/images/products/CHCHD2-Antibody-Western-Blot-NBP2-92335-img0009.jpg "Western Blot: CHCHD2 AntibodyAzide and BSA Free [NBP2-92335]")
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 75-145 of human CHCHD2 (NP_057223.1). TLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for CHCHD2 Antibody - Azide and BSA Free
Western Blot: CHCHD2 AntibodyAzide and BSA Free [NBP2-92335]
Western Blot: CHCHD2 Antibody [NBP2-92335] - Western blot analysis of extracts from normal (control) and CHCHD2 knockout (KO) 293T cells, using CHCHD2 antibody (NBP2-92335) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.![Western Blot: CHCHD2 AntibodyAzide and BSA Free [NBP2-92335]](https://resources.rndsystems.com/images/products/CHCHD2-Antibody-Western-Blot-NBP2-92335-img0003.jpg "Western Blot: CHCHD2 AntibodyAzide and BSA Free [NBP2-92335]")
Western Blot: CHCHD2 AntibodyAzide and BSA Free [NBP2-92335]
Western Blot: CHCHD2 Antibody [NBP2-92335] - Analysis of extracts of various cell lines, using CHCHD2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.![Immunohistochemistry-Paraffin: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]](https://resources.rndsystems.com/images/products/CHCHD2-Antibody-Immunohistochemistry-Paraffin-NBP2-92335-img0008.jpg "Immunohistochemistry-Paraffin: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]")
Immunohistochemistry-Paraffin: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]
Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP2-92335] - Immunohistochemistry of paraffin-embedded Rat ovary using [KO Validated] CHCHD2 Rabbit pAb (NBP2-92335) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]](https://resources.rndsystems.com/images/products/CHCHD2-Antibody-Immunohistochemistry-Paraffin-NBP2-92335-img0004.jpg "Immunohistochemistry-Paraffin: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]")
Immunohistochemistry-Paraffin: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]
Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP2-92335] - Mouse kidney using [KO Validated] CHCHD2 Rabbit pAb (A16645) at dilution of 1:100 (40x lens).![Immunohistochemistry-Paraffin: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]](https://resources.rndsystems.com/images/products/CHCHD2-Antibody-Immunohistochemistry-Paraffin-NBP2-92335-img0006.jpg "Immunohistochemistry-Paraffin: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]")
Immunohistochemistry-Paraffin: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]
Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP2-92335] - Human colon carcinoma using [KO Validated] CHCHD2 RabbitpAb (A16645) at dilution of 1:100 (40x lens).![Immunocytochemistry/ Immunofluorescence: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]](https://resources.rndsystems.com/images/products/CHCHD2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92335-img0001.jpg "Immunocytochemistry/ Immunofluorescence: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]")
Immunocytochemistry/ Immunofluorescence: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335]
Immunocytochemistry/Immunofluorescence: CHCHD2 Antibody [NBP2-92335] - Analysis of L929 cells using CHCHD2 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335] -
Immunocytochemistry/ Immunofluorescence: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335] - Immunofluorescence analysis of U-2 OS cells using [KO Validated] CHCHD2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335] -
Immunocytochemistry/ Immunofluorescence: CHCHD2 Antibody - Azide and BSA Free [NBP2-92335] - Immunofluorescence analysis of C6 cells using [KO Validated] CHCHD2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for CHCHD2 Antibody - Azide and BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL
Immunocytochemistry/ Immunofluorescence
1:50-1:200
Immunohistochemistry
1:50-1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: CHCHD2
Alternate Names
16.7kD protein, AAG10, coiled-coil-helix-coiled-coil-helix domain containing 2, coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial, HCV NS2 trans-regulated protein
Gene Symbol
CHCHD2
Additional CHCHD2 Products
Product Documents for CHCHD2 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CHCHD2 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCustomer Reviews for CHCHD2 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review CHCHD2 Antibody - Azide and BSA Free and earn rewards!
Have you used CHCHD2 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...