Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32596

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cytosolic Sulfotransferase 2B1/SULT2B1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: HIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Western Blot: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP2-32596]

Western Blot: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP2-32596]

Western Blot: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP2-32596] - Analysis in human cell line CAPAN-2
Immunocytochemistry/ Immunofluorescence: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP2-32596]

Immunocytochemistry/ Immunofluorescence: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP2-32596]

Immunocytochemistry/Immunofluorescence: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP2-32596] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP2-32596]

Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP2-32596]

Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP2-32596] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody Antibody [NBP2-32596]

Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody Antibody [NBP2-32596]

Staining of human lymph node, prostate, skin and small intestine using NBP2-32596 (A) shows similar protein distribution across tissues to independent antibody NBP2-33396 (B).

Applications for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytosolic Sulfotransferase 2B1/SULT2B1

Sulfotransferase family cytosolic 2B member 1 isoform b, also known as SULT2B1, is a member of Sulfotransferase family. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. SULT2B1b is localized in the cytosol and nuclei of human cells. SULT2B1b is selective for the sulfation of 3beta-hydroxysteroids such as dehydroepiandrosterone and pregnenolone, and may also have a role in cholesterol sulfation in human skin. Recombinant human SULT2B1, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.

Alternate Names

HSST2, SULT2B1

Gene Symbol

SULT2B1

Additional Cytosolic Sulfotransferase 2B1/SULT2B1 Products

Product Documents for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Sulfation Regulators

Customer Reviews for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free and earn rewards!

Have you used Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies