Desmin Antibody (6O9O4)

Novus Biologicals | Catalog # NBP3-33531

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 6O9O4
View all Desmin Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 371-470 of human Desmin (P17661).

Sequence:
EEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Desmin Antibody (6O9O4)

Desmin Antibody (6O9O4)

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] -

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human prostate cancer tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Desmin Antibody (6O9O4)

Western Blot: Desmin Antibody (6O9O4) [NBP3-33531] -

Western Blot: Desmin Antibody (6O9O4) [NBP3-33531] - Western blot analysis of various lysates using Desmin Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
Desmin Antibody (6O9O4)

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] -

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human prostate cancer tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Desmin Antibody (6O9O4)

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] -

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Desmin Antibody (6O9O4)

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] -

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human lung tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Desmin Antibody (6O9O4)

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] -

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human stomach tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Desmin Antibody (6O9O4)

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] -

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human smooth muscle tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Applications for Desmin Antibody (6O9O4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:1000 - 1:5000

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Desmin

Desmin is the protein subunit of muscle-type intermediate filaments (IFs). Desmin is one of the five major groups of IFs and is found predominantly in skeletal, cardiac, and smooth muscle.DE-U-10 labels desmin in tumors derived from muscle tissue (leiomyomas and rhabdomyosarcomas) (Debus E et al.).

Alternate Names

CMD1I, DES

Gene Symbol

DES

Additional Desmin Products

Product Documents for Desmin Antibody (6O9O4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Desmin Antibody (6O9O4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cardiac Stem Cell Markers

Customer Reviews for Desmin Antibody (6O9O4)

There are currently no reviews for this product. Be the first to review Desmin Antibody (6O9O4) and earn rewards!

Have you used Desmin Antibody (6O9O4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies