Fas/TNFRSF6/CD95 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89034

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Fas/TNFRSF6/CD95 Antibody - BSA Free

Western Blot: Fas/TNFRSF6/CD95 Antibody [NBP1-89034]

Western Blot: Fas/TNFRSF6/CD95 Antibody [NBP1-89034]

Western Blot: Fas Receptor/TNFRSF6/CD95 Antibody [NBP1-89034] - Fas/TNFRSF6/CD95 Antibody [NBP1-89034] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: Fas/TNFRSF6/CD95 Antibody [NBP1-89034]

Immunocytochemistry/ Immunofluorescence: Fas/TNFRSF6/CD95 Antibody [NBP1-89034]

Immunocytochemistry/Immunofluorescence: Fas Receptor/TNFRSF6/CD95 Antibody [NBP1-89034] - Fas/TNFRSF6/CD95 Antibody [NBP1-89034] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies, plasma membrane & cytosol. Antibody staining is show in green.
Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NBP1-89034]

Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NBP1-89034]

Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NBP1-89034] - Staining in human rectum and skeletal muscle tissues using anti-Fas/TNFRSF6/CD95 antibody. Corresponding Fas/TNFRSF6/CD95 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NBP1-89034]

Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NBP1-89034]

Immunohistochemistry-Paraffin: Fas Receptor/TNFRSF6/CD95 Antibody [NBP1-89034] - Fas/TNFRSF6/CD95 Antibody [NBP1-89034] - Staining of human rectum shows high expression.
Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NBP1-89034]

Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NBP1-89034]

Immunohistochemistry-Paraffin: Fas Receptor/TNFRSF6/CD95 Antibody [NBP1-89034] - Fas/TNFRSF6/CD95 Antibody [NBP1-89034] - Staining of human skeletal muscle shows low expression as expected.

Applications for Fas/TNFRSF6/CD95 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fas/TNFRSF6/CD95

Tumor Necrosis Family Receptor (TNFR) superfamily member Fas, also known as CD95, APO-1, and TNFRSF6, is a 40-50 kDa type I transmembrane glycoprotein that is traditionally considered a death receptor but also functions in non-apoptotic signaling (1-4). The human Fas/TNFRSF6/CD95 protein is encoded by the FAS gene which contains 9 exons and is located on chromosome 10 (10q23.3-4) (1,2). The mature canonical Fas/TNFRSF6 protein isoform is 335 aa in length, which includes the signal sequence, and has a theoretical molecular weight of 37.7 kDa (1,5). The protein contains an extracellular domain (ECD) consisting of three calcium rich domains (CRDs), a transmembrane domain (TM), and an intracellular domain (ICD) comprised of a calcium-inducing domain (CID) and characteristic dead domain (DD) (1,2,5,6). The Fas protein is expressed on the plasma membrane of activated lymphocytes as a homotrimer formed via CRD1 interactions (1,2,3,6). The DD is crucial for apoptotic signaling which is triggered by the Fas receptor binding its ligand, Fas ligand (FasL) (1,2,6,7). Upon Fas-FasL interaction, the DD recruits an adapter protein Fas-associated DD (FADD) and procaspase-8, generating the death-inducing signaling complex (DISC) (1-4,6-8). Formation of DISC activates caspase-8 and leads to cleavage of caspase-3, initiating a caspase-signaling cascade and cell death (1-4,6-8).

Fas-FasL-mediated apoptosis is important in immune homeostasis and removal of autoreactive T cells, autoreactive B cells, cytotoxic natural killer (NK) cells, and more (1,2,7). Dysfunction and mutations in the Fas receptor and the Fas-FasL signaling axis is associated a loss of apoptotic signaling and removal of autoreactive cells, which correlates with several autoimmune diseases including systemic lupus erythematosus (SLE), autoimmune lymphoproliferative syndrome (ALPS), and multiple sclerosis (MS) (1-4,6,7). In addition to apoptosis and cell death signaling, FasL/TNFRSF6/CD95 mediates other pathways involved in proliferation, survival, and differentiation (3,4,6,8). More specifically, Fas has been shown to activate the NF-kappaB pathway, driving innate immunity which includes IL-1beta production and functioning in host defense (3,4,6,8). Fas is also involved in adaptive immunity playing a role in co-stimulation of CD4+ and CD8+ T cell activation as well as precocious differentiation of naive cells to effector memory T cells (3,4,6). Differentiation into effector memory T cells shows protection against autoimmunity but also limits antitumor response to a form of cancer immunotherapy called adoptive cell transfer (ACT) (3,4). The non-apoptotic roles of the Fas/TNFRSF6/CD95 receptor highlight its potential as a target for both treating autoimmune diseases and in cancer immunotherapy (3,4).

References

1. Singh R, Pradhan V, Patwardhan M, Ghosh K. APO-1/Fas gene: Structural and functional characteristics in systemic lupus erythematosus and other autoimmune diseases. Indian J Hum Genet. 2009;15(3):98-102. https://doi.org/10.4103/0971-6866.60184

2. Magerus A, Bercher-Brayer C, Rieux-Laucat F. The genetic landscape of the FAS pathway deficiencies. Biomed J. 2021;44(4):388-399. https://doi.org/1010.1016/j.bj.2021.06.005

3. Guegan JP, Legembre P. Nonapoptotic functions of Fas/CD95 in the immune response. FEBS J. 2018;285(5):809-827. https://doi.org/10.1111/febs.14292

4. Yi F, Frazzette N, Cruz AC, Klebanoff CA, Siegel RM. Beyond Cell Death: New Functions for TNF Family Cytokines in Autoimmunity and Tumor Immunotherapy. Trends Mol Med. 2018;24(7):642-653. https://doi.org/10.1016/j.molmed.2018.05.004

5. Uniprot (P25445)

6. Guegan JP, Ginestier C, Charafe-Jauffret E, et al. CD95/Fas and metastatic disease: What does not kill you makes you stronger. Semin Cancer Biol. 2020;60:121-131. https://doi.org/10.1016/j.semcancer.2019.06.004

7. Volpe E, Sambucci M, Battistini L, Borsellino G. Fas-Fas Ligand: Checkpoint of T Cell Functions in Multiple Sclerosis. Front Immunol. 2016;7:382. Published 2016 Sep 27. https://doi.org/10.3389/fimmu.2016.00382

8. Cullen SP, Martin SJ. Fas and TRAIL 'death receptors' as initiators of inflammation: Implications for cancer. Semin Cell Dev Biol. 2015;39:26-34. https://doi.org/10.1016/j.semcdb.2015.01.012

Long Name

Fibroblast-associated

Alternate Names

Apo-1, APT1, CD95, TNFRSF6

Gene Symbol

FAS

Additional Fas/TNFRSF6/CD95 Products

Product Documents for Fas/TNFRSF6/CD95 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fas/TNFRSF6/CD95 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Fas/TNFRSF6/CD95 Antibody - BSA Free

Customer Reviews for Fas/TNFRSF6/CD95 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Fas/TNFRSF6/CD95 Antibody - BSA Free and earn rewards!

Have you used Fas/TNFRSF6/CD95 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies