Hexokinase 1 Antibody (6B7Q2)

Novus Biologicals | Catalog # NBP3-15274

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6B7Q2 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Hexokinase 1 (P19367). GLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

102 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Hexokinase 1 Antibody (6B7Q2)

Western Blot: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Western Blot: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Western Blot: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274] - Western blot analysis of extracts of various cell lines, using Hexokinase 1 Rabbit mAb (NBP3-15274) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Immunocytochemistry/ Immunofluorescence: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Immunocytochemistry/Immunofluorescence: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274] - Immunofluorescence analysis of U-2 OS cells using Hexokinase 1 Rabbit mAb (NBP3-15274) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Immunohistochemistry-Paraffin: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Immunohistochemistry-Paraffin: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274] - Immunohistochemistry of paraffin-embedded mouse kidney using Hexokinase 1 Rabbit mAb (NBP3-15274) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Immunohistochemistry-Paraffin: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Immunohistochemistry-Paraffin: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274] - Immunohistochemistry of paraffin-embedded rat kidney using Hexokinase 1 Rabbit mAb (NBP3-15274) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Immunohistochemistry-Paraffin: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Immunohistochemistry-Paraffin: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274] - Immunohistochemistry of paraffin-embedded human thyroid cancer using Hexokinase 1 Rabbit mAb (NBP3-15274) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Knockout Validated: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Western Blot: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Western Blot: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274] - Western blot analysis of extracts from normal (control) and Hexokinase 1 knockout (KO) 293T cells, using Hexokinase 1 Rabbit mAb (NBP3-15274) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunoprecipitation: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Immunoprecipitation: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274]

Immunoprecipitation: Hexokinase 1 Antibody (6B7Q2) [NBP3-15274] - Immunoprecipitation analysis of 600ug extracts of Mouse brain cells using 3ug Hexokinase 1 antibody (NBP3-15274). Western blot was performed from the immunoprecipitate using Hexokinase 1 (NBP3-15274) at a dilition of 1:1000.
Hexokinase 1 Antibody (6B7Q2)

Immunocytochemistry/ Immunofluorescence: Hexokinase 1 Antibody (6B7Q2) [Hexokinase 1] -

Immunocytochemistry/ Immunofluorescence: Hexokinase 1 Antibody (6B7Q2) [Hexokinase 1] - Confocal imaging of U-2 OS cells using [KO Validated] Hexokinase 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Hexokinase 1 Antibody (6B7Q2)

Immunohistochemistry: Hexokinase 1 Antibody (6B7Q2) [Hexokinase 1] -

Immunohistochemistry: Hexokinase 1 Antibody (6B7Q2) [Hexokinase 1] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using [KO Validated] Hexokinase 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Hexokinase 1 Antibody (6B7Q2)

Immunocytochemistry/ Immunofluorescence: Hexokinase 1 Antibody (6B7Q2) [Hexokinase 1] -

Immunocytochemistry/ Immunofluorescence: Hexokinase 1 Antibody (6B7Q2) [Hexokinase 1] - Confocal imaging of paraffin-embedded Mouse kidney tissue using [KO Validated] Hexokinase 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
Hexokinase 1 Antibody (6B7Q2)

Immunohistochemistry: Hexokinase 1 Antibody (6B7Q2) [Hexokinase 1] -

Immunohistochemistry: Hexokinase 1 Antibody (6B7Q2) [Hexokinase 1] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using [KO Validated] Hexokinase 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Hexokinase 1 Antibody (6B7Q2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:200 - 1:800

Immunohistochemistry

1:200 - 1:800

Immunohistochemistry-Paraffin

1:200 - 1:800

Immunoprecipitation

0.5μg-4μg antibody for 400μg-600μg extracts of whole cells

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Hexokinase 1

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in five transcript variants which encode different isoforms, some of which are tissue-specific. Each isoform has a distinct N-terminus; the remainder of the protein is identical among all the isoforms. A sixth transcript variant has been described, but due to the presence of several stop codons, it is not thought to encode a protein.

Alternate Names

HK1, HKI

Gene Symbol

HK1

Additional Hexokinase 1 Products

Product Documents for Hexokinase 1 Antibody (6B7Q2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hexokinase 1 Antibody (6B7Q2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hexokinase 1 Antibody (6B7Q2)

There are currently no reviews for this product. Be the first to review Hexokinase 1 Antibody (6B7Q2) and earn rewards!

Have you used Hexokinase 1 Antibody (6B7Q2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...