IL-11 Ra (Interleukin-11 receptor alpha) is a widely expressed transmembrane protein that associates with gp130 to form a functional receptor complex for the cytokine IL-11. gp130 also functions as a subunit in the receptors for Cardiotrophin-1, CNTF, IL-6, IL-27, IL-31, LIF, and Oncostatin M. IL-11 Ra plays a role in female reproduction and the survival of oligodendrocytes and colonic epithelial cells. It enhances osteoclast differentiation and bone remodeling but inhibits adipocyte differentiation. Soluble IL-11 Ra confers IL-11 responsiveness to cells expressing gp130, while in cells expressing transmembrane IL-11 Ra and gp130, soluble IL-11 Ra acts as an IL-11 antagonist.
IL-11R alpha Antibody (10Z3S9)
Novus Biologicals | Catalog # NBP3-16809
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 10Z3S9 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 323-422 of human IL-11R alpha (Q14626). EIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAPNL
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for IL-11R alpha Antibody (10Z3S9)
Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809]
Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Western blot analysis of extracts of various cell lines, using (NBP3-16809) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809]
Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Western blot analysis of extracts of Rat brain, using (NBP3-16809) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.Immunocytochemistry/ Immunofluorescence: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -
Immunocytochemistry/ Immunofluorescence: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Confocal imaging of K-562 cells using IL-11R alpha Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 100x.Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -
Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded human colon tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -
Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded mouse brain tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -
Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded rat spleen tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -
Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded human liver cancer tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunocytochemistry/ Immunofluorescence: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -
Immunocytochemistry/ Immunofluorescence: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Confocal imaging of RAW 264.7 cells using IL-11R alpha Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 100x.Applications for IL-11R alpha Antibody (10Z3S9)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: IL-11 R alpha
Long Name
Interleukin 11 Receptor alpha
Alternate Names
IL-11Ra, IL11R alpha, IL11RA
Gene Symbol
IL11RA
Additional IL-11 R alpha Products
Product Documents for IL-11R alpha Antibody (10Z3S9)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for IL-11R alpha Antibody (10Z3S9)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for IL-11R alpha Antibody (10Z3S9)
There are currently no reviews for this product. Be the first to review IL-11R alpha Antibody (10Z3S9) and earn rewards!
Have you used IL-11R alpha Antibody (10Z3S9)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...