IL-11R alpha Antibody (10Z3S9)

Novus Biologicals | Catalog # NBP3-16809

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10Z3S9 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 323-422 of human IL-11R alpha (Q14626). EIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAPNL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for IL-11R alpha Antibody (10Z3S9)

Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809]

Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809]

Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Western blot analysis of extracts of various cell lines, using (NBP3-16809) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809]

Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809]

Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Western blot analysis of extracts of Rat brain, using (NBP3-16809) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
IL-11R alpha Antibody (10Z3S9)

Immunocytochemistry/ Immunofluorescence: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -

Immunocytochemistry/ Immunofluorescence: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Confocal imaging of K-562 cells using IL-11R alpha Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 100x.
IL-11R alpha Antibody (10Z3S9)

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded human colon tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
IL-11R alpha Antibody (10Z3S9)

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded mouse brain tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
IL-11R alpha Antibody (10Z3S9)

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded rat spleen tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
IL-11R alpha Antibody (10Z3S9)

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded human liver cancer tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
IL-11R alpha Antibody (10Z3S9)

Immunocytochemistry/ Immunofluorescence: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] -

Immunocytochemistry/ Immunofluorescence: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Confocal imaging of RAW 264.7 cells using IL-11R alpha Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for IL-11R alpha Antibody (10Z3S9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: IL-11 R alpha

IL-11 Ra (Interleukin-11 receptor alpha) is a widely expressed transmembrane protein that associates with gp130 to form a functional receptor complex for the cytokine IL-11. gp130 also functions as a subunit in the receptors for Cardiotrophin-1, CNTF, IL-6, IL-27, IL-31, LIF, and Oncostatin M. IL-11 Ra plays a role in female reproduction and the survival of oligodendrocytes and colonic epithelial cells. It enhances osteoclast differentiation and bone remodeling but inhibits adipocyte differentiation. Soluble IL-11 Ra confers IL-11 responsiveness to cells expressing gp130, while in cells expressing transmembrane IL-11 Ra and gp130, soluble IL-11 Ra acts as an IL-11 antagonist.

Long Name

Interleukin 11 Receptor alpha

Alternate Names

IL-11Ra, IL11R alpha, IL11RA

Gene Symbol

IL11RA

Additional IL-11 R alpha Products

Product Documents for IL-11R alpha Antibody (10Z3S9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-11R alpha Antibody (10Z3S9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IL-11R alpha Antibody (10Z3S9)

There are currently no reviews for this product. Be the first to review IL-11R alpha Antibody (10Z3S9) and earn rewards!

Have you used IL-11R alpha Antibody (10Z3S9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...