IL-1ra (IL-1 receptor antagonist) is a widely expressed acute phase protein that serves to dampen inflammation. IL-1ra binds to both IL-1 RI and IL-1 RII. It competitively inhibits IL-1 (alpha or beta) binding to IL-1 RI and does not trigger recruitment of the accessory molecule IL-1 R AcP or activation of IL-1 RI signaling. IL-1ra blocks the proinflammatory actions of IL-1 including Prostaglandin E2 and IL-6 release from endothelial cells, fever generation, thrombocytosis, the production of hepatic acute phase proteins, and neutrophil expansion and infiltration.
IL-1ra/IL-1F3/IL1RN Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-81616
![Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]](https://beta-resources.rndsystems.com/images/products/IL-1ra-IL-1F3-IL1RN-Antibody-Immunohistochemistry-Paraffin-NBP1-81616-img0013.jpg "Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKF
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit IL-1ra/IL-1F3/IL1RN Antibody - BSA Free (NBP1-81616) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for IL-1ra/IL-1F3/IL1RN Antibody - BSA Free
![Western Blot: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]](https://beta-resources.rndsystems.com/images/products/IL-1ra-IL-1F3-IL1RN-Antibody-Western-Blot-NBP1-81616-img0009.jpg "Western Blot: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]")
Western Blot: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]
Western Blot: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616] - Analysis in human cell line RT-4.![Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]](https://beta-resources.rndsystems.com/images/products/IL-1ra-IL-1F3-IL1RN-Antibody-Immunohistochemistry-Paraffin-NBP1-81616-img0017.jpg "Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]")
Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]
Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616] - Staining of human skin shows weak to moderate positivity in squamous epithelial cells.![Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]](https://beta-resources.rndsystems.com/images/products/IL-1ra-IL-1F3-IL1RN-Antibody-Immunohistochemistry-Paraffin-NBP1-81616-img0014.jpg "Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]")
Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]
Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616] - Staining of human colon shows no positivity in glandular cells as expected.![Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]](https://beta-resources.rndsystems.com/images/products/IL-1ra-IL-1F3-IL1RN-Antibody-Immunohistochemistry-Paraffin-NBP1-81616-img0015.jpg "Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]")
Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]
Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616] - Staining of human esophagus shows moderate to strong positivity in squamous epithelial cells.![Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]](https://beta-resources.rndsystems.com/images/products/IL-1ra-IL-1F3-IL1RN-Antibody-Immunohistochemistry-Paraffin-NBP1-81616-img0016.jpg "Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]")
Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]
Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616] - Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.![Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]](https://beta-resources.rndsystems.com/images/products/IL-1ra-IL-1F3-IL1RN-Antibody-Immunohistochemistry-Paraffin-NBP1-81616-img0018.jpg "Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]")
Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616]
Immunohistochemistry-Paraffin: IL-1ra/IL-1F3/IL1RN Antibody [NBP1-81616] - Staining of human cervix, uterine shows moderate positivity in squamous epithelial cells.Applications for IL-1ra/IL-1F3/IL1RN Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: IL-1ra/IL-1F3
Long Name
Interleukin 1 Receptor Antagonist
Alternate Names
DIRA, ICIL-1ra, IL-1F3, IL-1ra3, IL-1RN, IL1ra, IL1RN, MVCD4
Gene Symbol
IL1RN
Additional IL-1ra/IL-1F3 Products
Product Documents for IL-1ra/IL-1F3/IL1RN Antibody - BSA Free
Product Specific Notices for IL-1ra/IL-1F3/IL1RN Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for IL-1ra/IL-1F3/IL1RN Antibody - BSA Free
There are currently no reviews for this product. Be the first to review IL-1ra/IL-1F3/IL1RN Antibody - BSA Free and earn rewards!
Have you used IL-1ra/IL-1F3/IL1RN Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...
Associated Pathways
