Integrin alpha V/CD51 Antibody (10T9N2)

Novus Biologicals | Catalog # NBP3-15647

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10T9N2 expressed in HEK293
View all Integrin alpha V/CD51 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human Integrin alpha V/CD51 (NP_002201.2). SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

116 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Integrin alpha V/CD51 Antibody (10T9N2)

Western Blot: Integrin alpha V/CD51 Antibody (10T9N2) [NBP3-15647]

Western Blot: Integrin alpha V/CD51 Antibody (10T9N2) [NBP3-15647]

Western Blot: Integrin alpha V/CD51 Antibody (7O8N2) [NBP3-15647] - Analysis of extracts of various cell lines, using Integrin alpha V/CD51 (ITGAV/CD51) antibody (NBP3-15647) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Integrin alpha V/CD51 Antibody (7O8N2)

ICC/IF: Integrin alpha V/CD51 Antibody (7O8N2) [NBP3-15647] -

ICC/IF: Integrin alpha V/CD51 Antibody (7O8N2) [NBP3-15647] -ITGAV Antibody [NBP3-15647] was used (1:100) for labeling and microscopy analysis of the distribution of ITGAV proteins in SUM159 cells. Validated customer review.
Integrin alpha V/CD51 Antibody (10T9N2)

Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] -

Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Integrin alpha V/CD51 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Integrin alpha V/CD51 Antibody (10T9N2)

Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] -

Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Integrin alpha V/CD51 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Integrin alpha V/CD51 Antibody (10T9N2)

Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] -

Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Integrin alpha V/CD51 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Integrin alpha V/CD51 Antibody (10T9N2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

Validated from a verified customer review

Immunohistochemistry

1:50 - 1:200

Western Blot

1:1000 - 1:6000

Reviewed Applications

Read 2 reviews rated 4.5 using NBP3-15647 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Integrin alpha V/CD51

Integrin alpha V chain interacts with the integrin beta 3 subunit/CD61 to form the alpha-V-beta-3 heterodimer/vitronectin receptor. It is expressed on endothelial cells, some activated leukocytes, NK cells, macrophages, neutrophils, and platelets. Integrin alpha V also forms heterodimers with the integrin beta 1, beta 5, beta 6, and beta 8 subunits. Alpha-V-beta-3 is an activation dependent receptor for platelet attachment and spreading on vitronectin and other matrix components.

Alternate Names

CD51, ITGAV, MSK8, Vitronectin Receptor alpha, VNRA

Gene Symbol

ITGAV

Additional Integrin alpha V/CD51 Products

Product Documents for Integrin alpha V/CD51 Antibody (10T9N2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Integrin alpha V/CD51 Antibody (10T9N2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Integrin alpha V/CD51 Antibody (10T9N2) (2)

4.5 out of 5
2 Customer Ratings
5 Stars
50%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Integrin alpha V/CD51 Antibody (10T9N2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • Integrin alpha V/CD51 Antibody (7O8N2)
    Name: Nick Dordai
    Application: Immunocytochemistry
    Sample Tested: SUM159
    Species: Human
    Verified Customer | Posted 12/01/2022
    Immunofluorescence (IF): ITGAV Antibody [NBP3-15647] was used (1:100) for labeling and microscopy analysis of the distribution of ITGAV proteins in SUM159 cells.
    Integrin alpha V/CD51 Antibody (10T9N2) NBP3-15647
  • Integrin alpha V/CD51 Antibody (7O8N2)
    Name: Anonymous
    Application: Western Blot
    Sample Tested: MDA-MB-231 Cell Lysate and SUM-159PT human breast cancer cell line
    Species: Human
    Verified Customer | Posted 10/20/2022
    Western Blot: whole cell lysates from MDA-MB-231 or SUM159PT cells was loaded with 50 ug/lane. 10% SDS-PAGE. ITGAV Antibody (NBP3-15647) was used for primary antibody: 1:2000, 4℃, overnight.
    Integrin alpha V/CD51 Antibody (10T9N2) NBP3-15647

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies