Q: I'm looking for a good antibody for integrins that works in rats. I would need it for Western Blot, Immunocyto- as well as Immunohistochemistry. I'm especially interested in beta1.

A: I would recommend NB110-57123 as it has been validated using rat samples in WB, IHC-P, and FACS. Although we do not list ICC on the datasheet for this antibody I believe it will work in ICC because it works in Flow Cytometry and has been validated to stain tissue. We have several other Integrin targets. To search for what you are looking for I recommend typing Integrin into the search area at the top of our website, then review the list of suggested targets that poplulate below the search. Once you click on a particular Integrin you can narrow the results with our filter. I recommend filtering to primary antibodies, by target name, species of interest you can filter to rat. If you so choose you can also filter further by application, host, clonality, etc.

Integrin beta 1/CD29 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62660

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

View all Integrin beta 1/CD29 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: FQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNE

Reactivity Notes

Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Integrin beta 1/CD29 Antibody - BSA Free (NBP2-62660) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Integrin beta 1/CD29 Antibody - BSA Free

Immunohistochemistry-Paraffin: Integrin beta 1/CD29 Antibody [NBP2-62660]

Immunohistochemistry-Paraffin: Integrin beta 1/CD29 Antibody [NBP2-62660] - Analysis in human smooth muscle and pancreas tissues using Anti-ITGB1 antibody. Corresponding ITGB1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Integrin beta 1/CD29 Antibody [NBP2-62660]

Immunohistochemistry-Paraffin: Integrin beta 1/CD29 Antibody [NBP2-62660] - Staining of human smooth muscle shows high expression.

Immunohistochemistry-Paraffin: Integrin beta 1/CD29 Antibody [NBP2-62660]

Immunohistochemistry-Paraffin: Integrin beta 1/CD29 Antibody [NBP2-62660] - Staining of human pancreas shows low expression as expected.

Applications for Integrin beta 1/CD29 Antibody - BSA Free

Application

Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Integrin beta 1/CD29

Integrin beta-1 (ITGB1, CD29, VLA-beta) is the beta subunit found in the integrin families, forming a heterodimer integrin receptor through non-covalent bonding with various integrin alpha subunits. Integrin heterodimer containing Integrin beta-1 binds to various cell surface and extracellular proteins (CD49a-f, CD51) to mediate cell to cell and cell to matrix adhesion (1). Integrin beta-1 plays a critical role in the cell adhesion and recognition in embryogenesis, hemostasis, immune response, tissue repair, metastatic diffusion of tumor cells and development (2, 3, 4).

Alternate Names

CD29, ITGB1

Gene Symbol

ITGB1

Additional Integrin beta 1/CD29 Products

Product Documents for Integrin beta 1/CD29 Antibody - BSA Free

Download Product Datasheets

Download SDS

Product Specific Notices for Integrin beta 1/CD29 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Adhesion Molecules

Adhesion Molecules on Endothelial Cells

Adipose-derived Stem Cell Markers

Cancer Biomarkers

Cardiac Stem Cell Markers

Epithelial Cell Polarity

Integrins and Associated Molecules

Mesenchymal Stem Cell Markers

Skin Stem Cell Markers

Customer Reviews for Integrin beta 1/CD29 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Integrin beta 1/CD29 Antibody - BSA Free and earn rewards!

Have you used Integrin beta 1/CD29 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Integrin beta 1/CD29 Antibody - BSA Free

Showing 1 - 1 of 1 FAQ Showing All

Q: I'm looking for a good antibody for integrins that works in rats. I would need it for Western Blot, Immunocyto- as well as Immunohistochemistry. I'm especially interested in beta1.

A: I would recommend NB110-57123 as it has been validated using rat samples in WB, IHC-P, and FACS. Although we do not list ICC on the datasheet for this antibody I believe it will work in ICC because it works in Flow Cytometry and has been validated to stain tissue. We have several other Integrin targets. To search for what you are looking for I recommend typing Integrin into the search area at the top of our website, then review the list of suggested targets that poplulate below the search. Once you click on a particular Integrin you can narrow the results with our filter. I recommend filtering to primary antibodies, by target name, species of interest you can filter to rat. If you so choose you can also filter further by application, host, clonality, etc.