Jagged 1 Antibody (1E12)

Novus Biologicals | Catalog # H00000182-M01A

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Knockout Validated, Immunohistochemistry, Western Blot, ELISA

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1E12
View all Jagged 1 Primary Antibodies »

Product Specifications

Immunogen

JAG1 (NP_000205, 531 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28848392).

Specificity

JAG1 (1E12)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Jagged 1 Antibody (1E12)

Western Blot: Jagged 1 Antibody (1E12) [H00000182-M01A]

Western Blot: Jagged 1 Antibody (1E12) [H00000182-M01A]

Western Blot: Jagged 1 Antibody (1E12.) [H00000182-M01A] - Western Blot detection against Immunogen (35.64 KDa).
Knockout Validated: Jagged 1 Antibody (1E12) [H00000182-M01A]

Immunohistochemistry: Jagged 1 Antibody (1E12) [H00000182-M01A]

Jagged-1-Antibody-1E12-Knockout-Validated-H00000182-M01A-img0002.jpg
Jagged 1 Antibody (1E12)

Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] -

Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Targeted loss of Jagged1 in adult mouse neurons causes a spatial memory deficit. A schematic representation of the Jagged1 floxed allele used to generate the mice with TAM-inducible loss of Jagged1 gene (A). Representative immunofluorescence images of single confocal z-plane showing a near complete loss of Jagged1 protein (green) from hippocampal pyramidal neurons labeled by NeuN (red) of Jagged1cKO mice (B). Representative images from immunoblots showing the expression of Jagged1, DNER in Jagged1cKO mice & control mice (C). GAPDH is used as a loading control. Bar graph showing the quantitation of optical densities of Jagged1 & DNER bands in CTLs & Jagged1cKO mice (D). A graphic showing the behavioral arena for Y-maze spontaneous alternation test (E). Jagged1cKO mice show a significant deficit in hippocampus dependent working memory in the Y-maze spontaneous alternation test (F). A diagram showing the experimental arena for the hidden arm version of the Y-maze (G). Jagged1cKO mice show a significant reduction in the time spent in the hidden arm, suggesting a spatial memory defect (H). A schematic showing the experimental setup for the Novel Object Displacement test (I). Jagged1cKO mice exhibit a statistical significant reduction in discrimination index, a measure of spatial memory defect (J). Scale bar in (B) is 50 μm. Graphs are represented as mean ± SEM, *p < 0.05, **p < 0.01, & ***p < 0.001. Image collected & cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Jagged 1 Antibody (1E12)

Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] -

Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Jagged1 regulates learning-dependent Notch induction & is enriched presynaptically. Fluorescent double-labeling shows the expression of Notch1 (red) following spatial exploration in CTLs & Jagged1cKO (A). Jagged1 labeling (green) is used to validate the absence of Jagged1 in the Jagged1cKO (Jag1cKOs) (A,C). Diagram summarizing the Notch1 fluorescence intensities distribution in randomly picked 69 & 71 CA1 neurons in CTLs & Jagged1cKOs, respectively (p < 0.001) (B). Double immunofluorescence of the Notch1 transcriptional target, Hes5, in CTLs & JaggedcKOs following spatial exploration (C). Diagram summarizing the Hes5 fluorescence intensity distribution in randomly picked 64 & 70 CA1 neurons in CTL & Jagged1cKO, respectively (p < 0.001) (D). Representatives gold Immuno-electron microscopy panels from three WT mice show that Jagged1 particles are localized in presynaptic terminals, bound to presynaptic vesicles (Pre) (E–E‴). Immunogold particles are also apparent at the Postsynaptic density (Post) (E,E″,E‴). Box Plot summarizing the particle counts in presynaptic & postsynaptic terminal areas drawn on Immunoelectromicroscopy micrograph for Jagged1 indicates that the presynapse is enriched with Jag1 particles as compared to the postsynaptic terminal (p < 0.001) (F). Scale bars are: 20 μm in (A), 10 μm in (C), 400 nm in (E–E‴). AU, arbitrary units; Pre, presynaptic; Post, postsynaptic; & Ax, axon. Image collected & cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Jagged 1 Antibody (1E12)

Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] -

Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Jagged1 expression in brains & CSF of AD patients. Representative double fluorescent immunolabelings for Jagged1 (green) & Notch1 (red) counterstained with Thioflavin-T or DAPI (blue) on postmortem brain sections comprising the hippocampal CA fields from healthy age-matched controls & AD patients (A–C). in healthy controls, Jagged1 is localized to somata of neurons where also Notch1 is expressed. As expected, Thioflavin-T labeling is negligible (A,A′). AD sections show fibrillary aggregates (B,B′) & (C,C′) core plaques double positive for Notch1 & Thioflavin-T. Jag1 expression is scattered in parenchyma & low in, degenerated neurons (white arrows) (B,B′). Jag1 overlays in small double positive aggregates for Notch1 & Thioflavin-T (100x magnification) in radiating plaques with a visible reduction in Jagged1 cellular expression (B–C′). Box plots summarizing the quantification of fluorescence intensities of Jagged1 immunolabeled neurons shows a significant reduction in Jagged1 expression in AD patients (p < 0.001). Image collected & cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Jagged 1 Antibody (1E12)

Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] -

Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Jagged1 expression in brains & CSF of AD patients. Representative double fluorescent immunolabelings for Jagged1 (green) & Notch1 (red) counterstained with Thioflavin-T or DAPI (blue) on postmortem brain sections comprising the hippocampal CA fields from healthy age-matched controls & AD patients (A–C). in healthy controls, Jagged1 is localized to somata of neurons where also Notch1 is expressed. As expected, Thioflavin-T labeling is negligible (A,A′). AD sections show fibrillary aggregates (B,B′) & (C,C′) core plaques double positive for Notch1 & Thioflavin-T. Jag1 expression is scattered in parenchyma & low in, degenerated neurons (white arrows) (B,B′). Jag1 overlays in small double positive aggregates for Notch1 & Thioflavin-T (100x magnification) in radiating plaques with a visible reduction in Jagged1 cellular expression (B–C′). Box plots summarizing the quantification of fluorescence intensities of Jagged1 immunolabeled neurons shows a significant reduction in Jagged1 expression in AD patients (p < 0.001). Image collected & cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Jagged 1 Antibody (1E12)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. Use in Immunohistochemistry reported in scientific literature (PMID: 30708185).

Formulation, Preparation, and Storage

Purification

Unpurified

Formulation

Ascites

Preservative

No Preservative

Concentration

This product is unpurified. The exact concentration of antibody is not quantifiable.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Jagged 1

The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.

Alternate Names

CD339, JAG1

Entrez Gene IDs

182 (Human)

Gene Symbol

JAG1

OMIM

118450 (Human)

UniProt

NP_000205

Additional Jagged 1 Products

Product Documents for Jagged 1 Antibody (1E12)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Jagged 1 Antibody (1E12)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Notch Pathway

Citations for Jagged 1 Antibody (1E12)

Customer Reviews for Jagged 1 Antibody (1E12)

There are currently no reviews for this product. Be the first to review Jagged 1 Antibody (1E12) and earn rewards!

Have you used Jagged 1 Antibody (1E12)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies