JunB/AP-1 Antibody - BSA Free

Name: JunB/AP-1 Antibody - BSA Free
Brand: Novus Biologicals
SKU: NBP1-89544
Price: 549 USD
Availability: InStock

Novus Biologicals | Catalog # NBP1-89544

Submit a review

Citations (1)

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

View all JunB Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for JunB/AP-1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: JunB/AP-1 Antibody [NBP1-89544]

Immunocytochemistry/Immunofluorescence: JunB/AP-1 Antibody [NBP1-89544] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544]

Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining in human fallopian tube and skeletal muscle tissues. Corresponding JUNB RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544]

Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544]

Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544]

Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544]

Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.

Western Blot: JunB/AP-1 Antibody - BSA Free [NBP1-89544]

Analysis in human cell lines MCF-7 and HEK293 using Anti-JUNB antibody. Corresponding JUNB RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Chromatin Immunoprecipitation-exo-Seq: JunB/AP-1 Antibody - BSA Free [NBP1-89544]

ChIP-Exo-Seq composite graph for Anti-JUNB (NBP1-89544) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Western Blot: JunB/AP-1 Antibody - BSA Free [NBP1-89544] -

Western blot of rDKK3/Kremen-1/DVL-1 mechanistic pathway. Representative western blot bands (a) and the densitometric quantification of DKK3 (b), Kremen-1 (c), DVL-1 (d), p-JNK (e), AP-1 (F), cleaved caspase-1 (g), and IL-1 beta (h) in the sham, vehicle, rDKK3, rDKK3 + scrambled siRNA, rDKK3 + Kremen-1 siRNA, and rDKK3 + DVL-1 siRNA groups 24 h after ICH. Data are expressed as the mean +/- SD. *p < 0.05 versus sham; #p < 0.05 versus vehicle; @p < 0.05 vs rDKK3 + scramble siRNA group, n = 6 animals per group Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32331523), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

View 6 more images

Applications for JunB/AP-1 Antibody - BSA Free

Application

Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 -1:500

Western Blot

0.04-0.4 ug/ml

Application Notes

IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: JunB

The c-Jun proto-oncogene was first identified as the cellular homolog of the avian sarcoma virus v-Jun oncogene. The c-Jun protein along with c-Fos is a component of the AP-1 transcriptional complex. c-Jun can form either Jun/Jun homodimers or Jun/Fos heterodimers via the leucine repeats in both proteins. Homo- and heterodimers bind to the TGACTCA consensus sequence present in numerous promoters and initially identified as the phorbol ester tumor promoter response element (TRE). Two additional genes, Jun B and Jun D have been shown to be almost identical to c-Jun in their C-terminal regions, which are involved in dimerization and DNA binding, whereas their N-terminal domains, which are involved in transcriptional activation, diverge. All three form heterodimers among themselves and with c-Fos and other members of the Fos gene family.

Long Name

JunB Proto-oncogene

Alternate Names

activator protein 1, AP-1, jun B proto-oncogene, transcription factor jun-B

Gene Symbol

JUNB

Additional JunB Products

Product Documents for JunB/AP-1 Antibody - BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for JunB/AP-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.