Leukotriene B4 R1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89959

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Leukotriene B4 R1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23631827)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Leukotriene B4 R1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Leukotriene B4 R1 Antibody [NBP1-89959]

Immunohistochemistry-Paraffin: Leukotriene B4 R1 Antibody [NBP1-89959]

Immunohistochemistry-Paraffin: Leukotriene B4 R1 Antibody [NBP1-89959] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
Leukotriene B4 R1 Antibody - BSA Free Western Blot: Leukotriene B4 R1 Antibody - BSA Free [NBP1-89959]

Western Blot: Leukotriene B4 R1 Antibody - BSA Free [NBP1-89959]

Analysis in control (vector only transfected HEK293T lysate) and LTB4R over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for Leukotriene B4 R1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Leukotriene B4 R1

BLTR2, also known as Leukotriene B4 Receptor 1, is a Chemoattractant Receptor that causes LTB4-induced chemotaxis, calcium mobilization, and inhibition of adenylyl cyclase. Portions of the coding regions of BLTR2 have been duplicated and are part of the 5' UTR noncoding regions of the clusters LS190955 (BLT1) and LS54843 (CIDE-B) on chromosome 14. BLTR2 has been reported in humans in peripheral blood leukocytes, mononuclear lymphocytes, and spleen. ESTs have been isolated from a broad array of human libraries, including brain, eye, fetal lung/testis/B-cell, heart, kidney, melanocyte/uterus/fetal heart, testis, tonsil, and uterus libraries

Long Name

Leukotriene B4 Receptor 1

Alternate Names

BLT1, Leukotriene B4R1, LTB4R, LTB4R1

Gene Symbol

LTB4R

Additional Leukotriene B4 R1 Products

Product Documents for Leukotriene B4 R1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Leukotriene B4 R1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Leukotriene B4 R1 Antibody - BSA Free

Customer Reviews for Leukotriene B4 R1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Leukotriene B4 R1 Antibody - BSA Free and earn rewards!

Have you used Leukotriene B4 R1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies