Methyltransferase like 3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03290

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human Methyltransferase like 3 (NP_062826.2). MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Methyltransferase like 3 Antibody - Azide and BSA Free

Methyltransferase like 3 Antibody - Azide and BSA Free

Western Blot: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] -

Western Blot: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Western blot analysis of lysates from wild type (WT) and Methyltransferase like 3 knockdown (KD) 293T cells using Methyltransferase like 3 Rabbit pAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Methyltransferase like 3 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] -

Immunocytochemistry/ Immunofluorescence: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Immunofluorescence analysis of PC-3 cells using Methyltransferase like 3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Methyltransferase like 3 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] -

Immunocytochemistry/ Immunofluorescence: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Immunofluorescence analysis of HepG2 cells using Methyltransferase like 3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Methyltransferase like 3 Antibody - Azide and BSA Free

Immunohistochemistry: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] -

Immunohistochemistry: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using Methyltransferase like 3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Methyltransferase like 3 Antibody - Azide and BSA Free

Western Blot: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] -

Western Blot: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Western blot analysis of various lysates using Methyltransferase like 3 Rabbit pAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Methyltransferase like 3 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] -

Immunocytochemistry/ Immunofluorescence: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Confocal immunofluorescence analysis of Hela cells using Methyltransferase like 3 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.
Methyltransferase like 3 Antibody - Azide and BSA Free

Immunohistochemistry: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] -

Immunohistochemistry: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using Methyltransferase like 3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Methyltransferase like 3 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: METTL3

Methyltransferase like 3 encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

Long Name

Methyltransferase like 3

Alternate Names

adoMet-binding subunit of the human mRNA (N6-adeno, hMETTL3, IME4, mRNA m(6)A methyltransferase, MT-A70, N6-adenosine-methyltransferase 70 kDa subunit, N6-adenosine-methyltransferase catalytic subunit, Spo8

Gene Symbol

METTL3

Additional METTL3 Products

Product Documents for Methyltransferase like 3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Methyltransferase like 3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Methyltransferase like 3 Antibody - Azide and BSA Free

Customer Reviews for Methyltransferase like 3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Methyltransferase like 3 Antibody - Azide and BSA Free and earn rewards!

Have you used Methyltransferase like 3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...