Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94511

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 251-350 of human Muscarinic Acetylcholine Receptor M1/CHRM1 (NP_000729.2). SPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

Western Blot: Muscarinic Acetylcholine Receptor M1/CHRM1 AntibodyAzide and BSA Free [NBP2-94511]

Western Blot: Muscarinic Acetylcholine Receptor M1/CHRM1 AntibodyAzide and BSA Free [NBP2-94511]

Western Blot: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP2-94511] - Analysis of extracts of various cell lines, using CHRM1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - Azide and BSA Free [NBP2-94511]

Immunocytochemistry/ Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - Azide and BSA Free [NBP2-94511]

Immunocytochemistry/Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP2-94511] - Analysis of SH-SY5Y cells using CHRM1 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - Azide and BSA Free [NBP2-94511]

Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - Azide and BSA Free [NBP2-94511]

Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP2-94511] - Mouse brain using CHRM1 Rabbit pAb at dilution of 1:200 (40x lens).
Immunocytochemistry/ Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - Azide and BSA Free [NBP2-94511]

Immunocytochemistry/ Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - Azide and BSA Free [NBP2-94511]

Immunocytochemistry/Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP2-94511] - Analysis of Neuro-2a cells using CHRM1 Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Applications for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:500 - 1:2000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CHRM1

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 1 is involved in mediation of vagally-induced bronchoconstriction and in the acid secretion of the gastrointestinal tract. The gene encoding this receptor is localized to 11q13.

Long Name

Cholinergic Receptor Muscarinic 1

Alternate Names

HM1, M1, M1R, mAChR M1

Gene Symbol

CHRM1

Additional CHRM1 Products

Product Documents for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free and earn rewards!

Have you used Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...