NDUFA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37940

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NDUFA4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NDUFA4 (NP_002480.1).

Sequence:
MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NDUFA4 Antibody - BSA Free

NDUFA4 Antibody

Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] -

Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFA4 Antibody

Immunocytochemistry/ Immunofluorescence: NDUFA4 Antibody [NBP3-37940] -

Immunocytochemistry/ Immunofluorescence: NDUFA4 Antibody [NBP3-37940] - Immunofluorescence analysis of L929 cells using [KO Validated] NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NDUFA4 Antibody

Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] -

Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Human liver using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFA4 Antibody

Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] -

Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFA4 Antibody

Immunocytochemistry/ Immunofluorescence: NDUFA4 Antibody [NBP3-37940] -

Immunocytochemistry/ Immunofluorescence: NDUFA4 Antibody [NBP3-37940] - Immunofluorescence analysis of U-2 OS cells using [KO Validated] NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NDUFA4 Antibody

Western Blot: NDUFA4 Antibody [NBP3-37940] -

Western Blot: NDUFA4 Antibody [NBP3-37940] - Western Blot analysis of lysates from wild type(WT) and NDUFA4 knockout (KO) 293T(KO) cells, using [KO Validated] NDUFA4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.

Applications for NDUFA4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFA4

NDUFA4 is encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Alternate Names

CI-9k, CI-MLRQ, Complex I 9kDa subunit, Complex I-MLRQ, FLJ27440, MGC104422, MGC126843, MGC126845, MLRQ, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 (9kD, MLRQ), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4, NADH-ubiquinone oxidoreductase MLRQ subunit

Gene Symbol

NDUFA4

Additional NDUFA4 Products

Product Documents for NDUFA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDUFA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFA4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFA4 Antibody - BSA Free and earn rewards!

Have you used NDUFA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies