Nodal Antibody (5C3) - Azide and BSA Free

Novus Biologicals | Catalog # H00004838-M03

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 5C3

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Localization

Secreted

Specificity

NODAL - nodal homolog (mouse)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Nodal Antibody (5C3) - Azide and BSA Free

Western Blot: Nodal Antibody (5C3) [H00004838-M03]

Western Blot: Nodal Antibody (5C3) [H00004838-M03]

Western Blot: Nodal Antibody (5C3) [H00004838-M03] - Analysis of NODAL expression in Raw 264.7 (Cat # L024V1).
Immunocytochemistry/ Immunofluorescence: Nodal Antibody (5C3) [H00004838-M03]

Immunocytochemistry/ Immunofluorescence: Nodal Antibody (5C3) [H00004838-M03]

Immunocytochemistry/Immunofluorescence: Nodal Antibody (5C3) [H00004838-M03] - Analysis of monoclonal antibody to NODAL on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Nodal Antibody (5C3) [H00004838-M03]

Immunohistochemistry-Paraffin: Nodal Antibody (5C3) [H00004838-M03]

Immunohistochemistry-Paraffin: Nodal Antibody (5C3) [H00004838-M03] - Analysis of monoclonal antibody to NODAL on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml
Western Blot: Nodal Antibody (5C3) [H00004838-M03]

Western Blot: Nodal Antibody (5C3) [H00004838-M03]

Western Blot: Nodal Antibody (5C3) [H00004838-M03] - Analysis of NODAL expression in HeLa (Cat # L013V1).
Western Blot: Nodal Antibody (5C3) [H00004838-M03]

Western Blot: Nodal Antibody (5C3) [H00004838-M03]

Western Blot: Nodal Antibody (5C3) [H00004838-M03] - Analysis of NODAL expression in PC-12 (Cat # L012V1).
ELISA: Nodal Antibody (5C3) [H00004838-M03]

ELISA: Nodal Antibody (5C3) [H00004838-M03]

ELISA: Nodal Antibody (5C3) [H00004838-M03] - Detection limit for recombinant GST tagged NODAL is approximately 0.3ng/ml as a capture antibody.

Applications for Nodal Antibody (5C3) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Nodal

The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.

Alternate Names

BMP-16

Entrez Gene IDs

4838 (Human)

Gene Symbol

NODAL

OMIM

601265 (Human)

Additional Nodal Products

Product Documents for Nodal Antibody (5C3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nodal Antibody (5C3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Nodal Antibody (5C3) - Azide and BSA Free

Customer Reviews for Nodal Antibody (5C3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Nodal Antibody (5C3) - Azide and BSA Free and earn rewards!

Have you used Nodal Antibody (5C3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies