PA2G4/EBP1 Antibody (9J9U5)

Novus Biologicals | Catalog # NBP3-16561

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9J9U5 expressed in HEK293
View all PA2G4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 300-394 of human PA2G4/EBP1 (NP_006182.2). ELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PA2G4/EBP1 Antibody (9J9U5)

Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Western blot analysis of extracts of various cell lines, using PA2G4/EBP1Rabbit mAb (NBP3-16561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunocytochemistry/ Immunofluorescence: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Immunocytochemistry/ Immunofluorescence: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Immunocytochemistry/Immunofluorescence: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunofluorescence analysis of NIH-3T3 cells using PA2G4/EBP1Rabbit mAb (NBP3-16561) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Western blot analysis of extracts of Rat brain, using PA2G4/EBP1Rabbit mAb (NBP3-16561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
PA2G4/EBP1 Antibody (9J9U5)

Immunohistochemistry: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] -

Immunohistochemistry: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunohistochemistry analysis of PA2G4/EBP1 in paraffin-embedded rat brain tissue using PA2G4/EBP1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PA2G4/EBP1 Antibody (9J9U5)

Immunohistochemistry: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] -

Immunohistochemistry: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunohistochemistry analysis of PA2G4/EBP1 in paraffin-embedded human pancreas tissue using PA2G4/EBP1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PA2G4/EBP1 Antibody (9J9U5)

Immunohistochemistry: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] -

Immunohistochemistry: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunohistochemistry analysis of PA2G4/EBP1 in paraffin-embedded mouse colon tissue using PA2G4/EBP1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PA2G4/EBP1 Antibody (9J9U5)

Immunohistochemistry: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] -

Immunohistochemistry: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunohistochemistry analysis of PA2G4/EBP1 in paraffin-embedded human colon carcinoma tissue using PA2G4/EBP1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for PA2G4/EBP1 Antibody (9J9U5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PA2G4

EBP1 encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified.

Long Name

Proliferation-Associated 2G4

Alternate Names

EBP1, HG4-1

Gene Symbol

PA2G4

Additional PA2G4 Products

Product Documents for PA2G4/EBP1 Antibody (9J9U5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PA2G4/EBP1 Antibody (9J9U5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PA2G4/EBP1 Antibody (9J9U5)

There are currently no reviews for this product. Be the first to review PA2G4/EBP1 Antibody (9J9U5) and earn rewards!

Have you used PA2G4/EBP1 Antibody (9J9U5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies