Peroxiredoxin 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38370

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Peroxiredoxin 5 Antibody - BSA Free

Western Blot: Peroxiredoxin 5 Antibody [NBP2-38370]

Western Blot: Peroxiredoxin 5 Antibody [NBP2-38370]

Western Blot: Peroxiredoxin 5 Antibody [NBP2-38370] - Analysis using Anti-PRDX5 antibody NBP2-38370 (A) shows similar pattern to independent antibody NBP2-38371 (B).
Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 5 Antibody [NBP2-38370]

Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 5 Antibody [NBP2-38370]

Immunocytochemistry/Immunofluorescence: Peroxiredoxin 5 Antibody [NBP2-38370] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Peroxiredoxin 5 Antibody - BSA Free Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Analysis in human fallopian tube and lymph node tissues. Corresponding RNA-seq data are presented for the same tissues.
Peroxiredoxin 5 Antibody - BSA Free Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Peroxiredoxin 5 Antibody - BSA Free Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Staining of human lymph node shows negative to very weak cytoplasmic positivity in non-germinal center cells.
Peroxiredoxin 5 Antibody - BSA Free Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Peroxiredoxin 5 Antibody - BSA Free Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.
Peroxiredoxin 5 Antibody - BSA Free Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Immunohistochemistry-Paraffin: Peroxiredoxin 5 Antibody [NBP2-38370]

Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Applications for Peroxiredoxin 5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Peroxiredoxin 5

Peroxiredoxin 5 encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene.

Alternate Names

ACR1, AOEB166, AOPP, PMP20, PRDX5, PRXV

Gene Symbol

PRDX5

UniProt

Additional Peroxiredoxin 5 Products

Product Documents for Peroxiredoxin 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Peroxiredoxin 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Peroxiredoxin 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Peroxiredoxin 5 Antibody - BSA Free and earn rewards!

Have you used Peroxiredoxin 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...