Pref-1/DLK1/FA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32358

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Pref-1/DLK1/FA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Analysis in human adrenal gland and rectum tissues using NBP2-32358 antibody. Corresponding DLK1 RNA-seq data are presented for the same tissues
Immunocytochemistry/ Immunofluorescence: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunocytochemistry/ Immunofluorescence: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunocytochemistry/Immunofluorescence: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human cell line SH-SY5Y shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human adrenal gland shows moderate membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human cerebral cortex shows no psotivity in neuronal cells as expected.
Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358]

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human rectum shows no positivity in glandular cells as expected.

Applications for Pref-1/DLK1/FA1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Pref-1/DLK1/FA1

DLK1 may have a role in neuroendocrine differentiation

Long Name

Preadipocyte Factor-1/Protein delta Homolog 1/Fetal Antigen 1

Alternate Names

DLK-1, DLK1, FA1, pG2, Pref1, ZOG

Gene Symbol

DLK1

Additional Pref-1/DLK1/FA1 Products

Product Documents for Pref-1/DLK1/FA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Pref-1/DLK1/FA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Pref-1/DLK1/FA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pref-1/DLK1/FA1 Antibody - BSA Free and earn rewards!

Have you used Pref-1/DLK1/FA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies