S5a/Angiocidin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37888

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for S5a/Angiocidin Antibody - BSA Free

Western Blot: S5a/Angiocidin Antibody [NBP2-37888]

Western Blot: S5a/Angiocidin Antibody [NBP2-37888]

Western Blot: S5a/Angiocidin Antibody [NBP2-37888] - Analysis in control (vector only transfected HEK293T lysate) and PSMD4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: S5a/Angiocidin Antibody [NBP2-37888]

Immunocytochemistry/ Immunofluorescence: S5a/Angiocidin Antibody [NBP2-37888]

Immunocytochemistry/Immunofluorescence: S5a/Angiocidin Antibody [NBP2-37888] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
S5a/Angiocidin Antibody - BSA Free Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888]

Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888]

Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
S5a/Angiocidin Antibody - BSA Free Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888]

Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888]

Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.
S5a/Angiocidin Antibody - BSA Free Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888]

Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888]

Staining of human tonsil shows moderate cytoplasmic and nuclear positivity in germinal center cells.
S5a/Angiocidin Antibody - BSA Free Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888]

Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888]

Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
S5a/Angiocidin Antibody - BSA Free Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888]

Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888]

Staining of human cerebral cortex, squamous epithelia, testis and tonsil HPA038807 (A) shows similar protein distribution across tissues to independent antibody HPA039252 (B).

Applications for S5a/Angiocidin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: S5a/Angiocidin

S5a/Angiocidin, also known as Anti-secretory Factor (ASF), is classified under the gene PSMD4, but is often referred to by a different name depending on the context in which it is described. S5a and ASF have identical 377 amino acid (aa) sequences, while Angiocidin is described as having an additional Gly255Glu256Arg257 sequence in its C-Terminus. The human protein shares 96% and 99% aa sequence identity with its mouse and rat orthologs, respectively. Structurally, it contains an N-terminal von Willebrand Factor type A domain and two C-terminal Ubiquitin-interacting motifs (UIM). It acts as a Ubiquitin-binding protein where it is most commonly referred to as S5a or in yeast as Rpn10. It is part of the 19S regulatory subunit of the 26S Proteasome where its UIM recognizes poly-ubiquitinated proteins destined for degradation. As a part of the proteasome complex, it may also recognize the Ubiquitin-like modifier FAT10. Free cytoplasmic forms also exist where its ubiquitination is catalyzed by a range of Ubiquitin E3 ligases from different classes. Therefore, experimentally S5a/Angiocidin may act as a useful substrate to monitor the activity of (E3) ligases, independent of their specific mechanisms of action. In cancer biology, where it is often referred to as Angiocidin, it is shown to slow tumor progression. It is found in the extracellular matrix of certain tumor subtypes, and it may act by suppressing angiogenesis or by directly inhibiting tumor cell growth. It also is found in several biological fluids where it is known primarily as ASF. It suppresses fluid secretion in response to enterotoxin and may act as an anti-inflammatory factor.

Long Name

26S Proteasome Regulatory Subunit S5a

Alternate Names

Angiocidin, ASF, Macropain, Mcb1, PSMD4, pUB-R5, Rpn10, S5a

Gene Symbol

PSMD4

UniProt

Additional S5a/Angiocidin Products

Product Documents for S5a/Angiocidin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for S5a/Angiocidin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for S5a/Angiocidin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review S5a/Angiocidin Antibody - BSA Free and earn rewards!

Have you used S5a/Angiocidin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...