Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90309

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Gel Supershift Assay, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cerebral cortex, kidney, placenta and testis using Anti-SERPINA1 antibody NBP1-90309 (A) shows similar protein distribution across tissues to independent antibody NBP1-90308 (B).
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Analysis in human kidney and cerebral cortex tissues using NBP1-90309 antibody. Corresponding SERPINA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human kidney shows moderate positivity in plasma.
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human placenta shows strong positivity in plasma in blood vessels.
Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free [NBP1-90309]

Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free [NBP1-90309]

Staining of human testis shows moderate positivity in plasma.
Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Serpin-A1-alpha-1-Antitrypsin-Antibody-Immunohistochemistry-NBP1-90309-img0031.jpg
Serpin A1/alpha 1-Antitrypsin Antibody

Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] -

Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Representative expression status for ANG, CA9, MMP9, MMP10, SERPINA1, APOE, SDC1, VEGFA, serpine1 & IL8 levels in tumor tissue.Insert Representative expression status for ANG, CA9, MMP9, MMP10, SERPINA1, APOE, SDC1, VEGFA, serpine1 & IL-8 levels in benign tissue. All images were captured at 400× magnification. Image collected & cropped by CiteAb from the following publication (https://diagnosticpathology.biomedcentral.com/articles/10.1186/s13000-0…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Serpin A1/alpha 1-Antitrypsin Antibody

Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] -

Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - SerpinA1 was regulated by SnailA. DLD-1 & SW480 cells were transfected with pcDNA-Snail (Snail), control vector pcDNA (vector), Snail siRNA (siSnail), or nontargeting siRNA (siNT), & Snail & serpinA1 protein levels were evaluated by western blot analysis. B. DLD-1 & SW480 cells were transfected with pcDNA-serpinA1 (serpinA1), control vector pcDNA (vector), serpinA1 siRNA (siSerpinA1), or nontargeting siRNA (siNT), & western blot analysis was performed for detection of Snail & SerpinA1 expression. C. DLD-1 & SW480 cells were transfected with pcDNA-Snail (Snail) or control vector pcDNA (vector), & ChIP assays were performed. The presence of the serpinA1 promoter (−516/−4) was verified in immunoprecipitates with either mouse IgG or anti-Snail antibodies, & assay inputs were analyzed using real-time PCR. The samples were loaded on agarose gels. D. Data show promoter enrichment in the anti-Snail immunoprecipitate relative to IgG. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26015410), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Serpin A1/alpha 1-Antitrypsin Antibody

Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] -

Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - SerpinA1 was regulated by SnailA. DLD-1 & SW480 cells were transfected with pcDNA-Snail (Snail), control vector pcDNA (vector), Snail siRNA (siSnail), or nontargeting siRNA (siNT), & Snail & serpinA1 protein levels were evaluated by western blot analysis. B. DLD-1 & SW480 cells were transfected with pcDNA-serpinA1 (serpinA1), control vector pcDNA (vector), serpinA1 siRNA (siSerpinA1), or nontargeting siRNA (siNT), & western blot analysis was performed for detection of Snail & SerpinA1 expression. C. DLD-1 & SW480 cells were transfected with pcDNA-Snail (Snail) or control vector pcDNA (vector), & ChIP assays were performed. The presence of the serpinA1 promoter (−516/−4) was verified in immunoprecipitates with either mouse IgG or anti-Snail antibodies, & assay inputs were analyzed using real-time PCR. The samples were loaded on agarose gels. D. Data show promoter enrichment in the anti-Snail immunoprecipitate relative to IgG. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26015410), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Serpin-A1-alpha-1-Antitrypsin-Antibody-Immunohistochemistry-NBP1-90309-img0030.jpg
Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free [NBP1-90309]

Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free [NBP1-90309]

Analysis in human plasma.
Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free [NBP1-90309]

Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free [NBP1-90309]

Analysis using antibody NBP1-90309 (A) shows similar pattern to independent antibody NBP1-90308 (B).
Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Immunocytochemistry/ Immunofluorescence: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]

Staining of human cell line Hep G2 shows localization to vesicles.

Applications for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500-1:5000

Simple Western

1:125

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Human fibroblast lysates from Alpha-1-antitrypsin deficiency (AATD) and normal patients as samples; separated by size; antibody dilution of 1:125; detected by Chemiluminescence.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Serpin A1/alpha 1-Antitrypsin

Alpha 1 Antitrypsin, also known as SERPINA1, is a plasma protein synthesised in the liver. It consists of a single polypeptide chain and has a molecular weight of 52 kDa. A serine protease inhibitor, its primary function is the protection of lung tissue from the action of neutrophil elastase. The average level of alpha 1 Antitrypsin in plasma is 1.3 g/l.

Alternate Names

A1AT, alpha 1-Antitrypsin, alpha 1-Proteinase Inhibitor

Gene Symbol

SERPINA1

Additional Serpin A1/alpha 1-Antitrypsin Products

Product Documents for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free

Customer Reviews for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free and earn rewards!

Have you used Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies