Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-90309
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western
Cited:
Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Gel Supershift Assay, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]
Immunocytochemistry/Immunofluorescence: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cerebral cortex, kidney, placenta and testis using Anti-SERPINA1 antibody NBP1-90309 (A) shows similar protein distribution across tissues to independent antibody NBP1-90308 (B).Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Analysis in human kidney and cerebral cortex tissues using NBP1-90309 antibody. Corresponding SERPINA1 RNA-seq data are presented for the same tissues.Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human kidney shows moderate positivity in plasma.Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cerebral cortex shows no positivity in neurons as expected.Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human placenta shows strong positivity in plasma in blood vessels.Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free [NBP1-90309]
Staining of human testis shows moderate positivity in plasma.Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]
Serpin-A1-alpha-1-Antitrypsin-Antibody-Immunohistochemistry-NBP1-90309-img0031.jpgImmunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] -
Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Representative expression status for ANG, CA9, MMP9, MMP10, SERPINA1, APOE, SDC1, VEGFA, serpine1 & IL8 levels in tumor tissue.Insert Representative expression status for ANG, CA9, MMP9, MMP10, SERPINA1, APOE, SDC1, VEGFA, serpine1 & IL-8 levels in benign tissue. All images were captured at 400× magnification. Image collected & cropped by CiteAb from the following publication (https://diagnosticpathology.biomedcentral.com/articles/10.1186/s13000-0…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] -
Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - SerpinA1 was regulated by SnailA. DLD-1 & SW480 cells were transfected with pcDNA-Snail (Snail), control vector pcDNA (vector), Snail siRNA (siSnail), or nontargeting siRNA (siNT), & Snail & serpinA1 protein levels were evaluated by western blot analysis. B. DLD-1 & SW480 cells were transfected with pcDNA-serpinA1 (serpinA1), control vector pcDNA (vector), serpinA1 siRNA (siSerpinA1), or nontargeting siRNA (siNT), & western blot analysis was performed for detection of Snail & SerpinA1 expression. C. DLD-1 & SW480 cells were transfected with pcDNA-Snail (Snail) or control vector pcDNA (vector), & ChIP assays were performed. The presence of the serpinA1 promoter (−516/−4) was verified in immunoprecipitates with either mouse IgG or anti-Snail antibodies, & assay inputs were analyzed using real-time PCR. The samples were loaded on agarose gels. D. Data show promoter enrichment in the anti-Snail immunoprecipitate relative to IgG. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26015410), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] -
Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - SerpinA1 was regulated by SnailA. DLD-1 & SW480 cells were transfected with pcDNA-Snail (Snail), control vector pcDNA (vector), Snail siRNA (siSnail), or nontargeting siRNA (siNT), & Snail & serpinA1 protein levels were evaluated by western blot analysis. B. DLD-1 & SW480 cells were transfected with pcDNA-serpinA1 (serpinA1), control vector pcDNA (vector), serpinA1 siRNA (siSerpinA1), or nontargeting siRNA (siNT), & western blot analysis was performed for detection of Snail & SerpinA1 expression. C. DLD-1 & SW480 cells were transfected with pcDNA-Snail (Snail) or control vector pcDNA (vector), & ChIP assays were performed. The presence of the serpinA1 promoter (−516/−4) was verified in immunoprecipitates with either mouse IgG or anti-Snail antibodies, & assay inputs were analyzed using real-time PCR. The samples were loaded on agarose gels. D. Data show promoter enrichment in the anti-Snail immunoprecipitate relative to IgG. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26015410), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309]
Serpin-A1-alpha-1-Antitrypsin-Antibody-Immunohistochemistry-NBP1-90309-img0030.jpgWestern Blot: Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free [NBP1-90309]
Analysis in human plasma.Applications for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:2500 - 1:5000
Immunohistochemistry-Paraffin
1:2500-1:5000
Simple Western
1:125
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Human fibroblast lysates from Alpha-1-antitrypsin deficiency (AATD) and normal patients as samples; separated by size; antibody dilution of 1:125; detected by Chemiluminescence.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Serpin A1/alpha 1-Antitrypsin
Alternate Names
A1AT, alpha 1-Antitrypsin, alpha 1-Proteinase Inhibitor
Gene Symbol
SERPINA1
Additional Serpin A1/alpha 1-Antitrypsin Products
Product Documents for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free
Customer Reviews for Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free and earn rewards!
Have you used Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...