SMURF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57554

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Rat

Predicted:

Mouse (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31076633).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SMURF2 Antibody - BSA Free

Western Blot: SMURF2 Antibody [NBP2-57554]

Western Blot: SMURF2 Antibody [NBP2-57554]

Western Blot: SMURF2 Antibody [NBP2-57554] - Analysis in human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: SMURF2 Antibody [NBP2-57554]

Immunocytochemistry/ Immunofluorescence: SMURF2 Antibody [NBP2-57554]

Immunocytochemistry/Immunofluorescence: SMURF2 Antibody [NBP2-57554] - Staining of human cell line BJ shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]

Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]

Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]

Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]

Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]

Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]

Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]

Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]

Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
SMURF2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SMURF2 Antibody - BSA Free [NBP2-57554] -

TRAF4 diminished the expression of Smurf2 to modulate the osteogenesis process of MSCs. a Coomassie blue staining of the coimmunoprecipitated mixture separated by SDS-PAGE. b Coimmunoprecipitated mixtures were separated by SDS-PAGE and evaluated by western blot. Endogenous TRAF4 and Smurf2 in MSCs interacted with each other. c Immunofluorescence assays showed the colocalization of TRAF4 and Smurf2 in MSCs (green TRAF4, red Smurf2, blue DAPI). d The Smad1 and Runx2 protein levels were decreased in the Sh-TRAF4 group and increased in the Sh-Smurf2 group compared with those in the NC1 group, while compared with Sh-TRAF4, Sh-TRAF4/Sh-Smurf2 rescued the expression of Smad1 and Runx2. The Smad1 and Run2 protein levels increased in the OE-TRAF4 group and decreased in the OE-Smurf2 group compared with the NC2 group, while the expression levels of Smad1 and Runx2 in the OE-TRAF4/OE-Smurf2 group was decreased compared with those observed in the OE-TRAF4 group. e The simultaneous knockdown of TRAF4 and Smurf2 increased the ARS and ALP staining compared with that in the Sh-TRAF4 group (scale bar = 250 um, black arrows), while the simultaneous overexpression of TRAF4 and Smurf2 decreased the ARS and ALP staining to the level observed in the NC2 group compared with OE-TRAF4 group (scale bar = 250 um, black arrows). Data in (d) and (e) are presented as the means +/- SD. *p < 0.05 (n = 3 independent experiments with three different MSC lines) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31076633), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SMURF2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMURF2

Smad ubiquitination regulatory factor proteins (Smurf1 and Smurf2) are E3 ubiquitin ligase that belongs to the Hect family. Smurf proteins play an important role as regulators in TGF-beta pathway by ubiquitinating Smads and Smads associated proteins for proteasome degradation (1). Specifically, Smurf1 interacts with Smad1 and Smad5 for degradation, while Smurf2 ubiquitinates Smad1 and Smad2. Smads also functions to recruit Smurfs to various pathway components such as TGF-beta and SnoN. In particular, Smad7 acts as an adaptor protein between Smurfs and TGF-Beta receptors, allowing the receptors to be marked by Smurfs for degradation (2). Smurf2 interacts with all members of Smad family except for Smad4 and it is expressed various tissues and cell lines, such as placenta and ovarian cancer cell lines. Smurf2 has been implicated in the tumor formation and diseases progression (3).

Long Name

SMAD Ubiquitination Regulatory Factor 2

Alternate Names

DKFZp686F0270, E3 ubiquitin ligase SMURF2, E3 ubiquitin-protein ligase SMURF2, EC 6.3.2, EC 6.3.2.-, hSMURF2, MGC138150, SMAD specific E3 ubiquitin protein ligase 2, SMAD ubiquitination regulatory factor 2, SMAD-specific E3 ubiquitin-protein ligase 2

Gene Symbol

SMURF2

Additional SMURF2 Products

Product Documents for SMURF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMURF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SMURF2 Antibody - BSA Free

Customer Reviews for SMURF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMURF2 Antibody - BSA Free and earn rewards!

Have you used SMURF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

TGF-beta Signaling Pathways
TGF-beta Signaling Pathway Thumbnail