SMURF2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-57554
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Rat
Cited:
Human, Rat
Predicted:
Mouse (96%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD
Reactivity Notes
Rat reactivity reported in scientific literature (PMID: 31076633).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SMURF2 Antibody - BSA Free
Western Blot: SMURF2 Antibody [NBP2-57554]
Western Blot: SMURF2 Antibody [NBP2-57554] - Analysis in human cell line U-251 MG.Immunocytochemistry/ Immunofluorescence: SMURF2 Antibody [NBP2-57554]
Immunocytochemistry/Immunofluorescence: SMURF2 Antibody [NBP2-57554] - Staining of human cell line BJ shows localization to nuclear speckles. Antibody staining is shown in green.Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]
Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]
Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]
Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554]
Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.Immunocytochemistry/ Immunofluorescence: SMURF2 Antibody - BSA Free [NBP2-57554] -
TRAF4 diminished the expression of Smurf2 to modulate the osteogenesis process of MSCs. a Coomassie blue staining of the coimmunoprecipitated mixture separated by SDS-PAGE. b Coimmunoprecipitated mixtures were separated by SDS-PAGE and evaluated by western blot. Endogenous TRAF4 and Smurf2 in MSCs interacted with each other. c Immunofluorescence assays showed the colocalization of TRAF4 and Smurf2 in MSCs (green TRAF4, red Smurf2, blue DAPI). d The Smad1 and Runx2 protein levels were decreased in the Sh-TRAF4 group and increased in the Sh-Smurf2 group compared with those in the NC1 group, while compared with Sh-TRAF4, Sh-TRAF4/Sh-Smurf2 rescued the expression of Smad1 and Runx2. The Smad1 and Run2 protein levels increased in the OE-TRAF4 group and decreased in the OE-Smurf2 group compared with the NC2 group, while the expression levels of Smad1 and Runx2 in the OE-TRAF4/OE-Smurf2 group was decreased compared with those observed in the OE-TRAF4 group. e The simultaneous knockdown of TRAF4 and Smurf2 increased the ARS and ALP staining compared with that in the Sh-TRAF4 group (scale bar = 250 um, black arrows), while the simultaneous overexpression of TRAF4 and Smurf2 decreased the ARS and ALP staining to the level observed in the NC2 group compared with OE-TRAF4 group (scale bar = 250 um, black arrows). Data in (d) and (e) are presented as the means +/- SD. *p < 0.05 (n = 3 independent experiments with three different MSC lines) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31076633), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SMURF2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SMURF2
Long Name
SMAD Ubiquitination Regulatory Factor 2
Alternate Names
DKFZp686F0270, E3 ubiquitin ligase SMURF2, E3 ubiquitin-protein ligase SMURF2, EC 6.3.2, EC 6.3.2.-, hSMURF2, MGC138150, SMAD specific E3 ubiquitin protein ligase 2, SMAD ubiquitination regulatory factor 2, SMAD-specific E3 ubiquitin-protein ligase 2
Gene Symbol
SMURF2
Additional SMURF2 Products
Product Documents for SMURF2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SMURF2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for SMURF2 Antibody - BSA Free
Customer Reviews for SMURF2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SMURF2 Antibody - BSA Free and earn rewards!
Have you used SMURF2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...