SOX9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85551

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat, Porcine, Canine

Cited:

Human, Mouse, Rat, Porcine, Canine

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, EMSA, IF/IHC, IHF-Fr

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SOX9 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR

Reactivity Notes

Use in Rat reported in scientific literature (PMID:33645550). Porcine reactivity reported in scientific Iliterature (PMID: 26430891). Use in Canine reported in scientific literature (PMID:26428883).

Marker

Sertoli Cell Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SOX9 Antibody - BSA Free (NBP1-85551) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-SOX9 Antibody: Cited in 25 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SOX9 Antibody - BSA Free

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining in human testis and skeletal muscle tissues. Corresponding SOX9 RNA-seq data are presented for the same tissues.
Knockdown Validated: SOX9 Antibody [NBP1-85551]

Western Blot: SOX9 Antibody [NBP1-85551]

Western Blot: SOX9 Antibody [NBP1-85551] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-SOX9 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: SOX9 Antibody [NBP1-85551]

Immunocytochemistry/ Immunofluorescence: SOX9 Antibody [NBP1-85551]

SOX9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85551-img0037.jpg
Western Blot: SOX9 Antibody [NBP1-85551]

Western Blot: SOX9 Antibody [NBP1-85551]

Western Blot: SOX9 Antibody [NBP1-85551] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: SOX9 Antibody [NBP1-85551]

Immunocytochemistry/ Immunofluorescence: SOX9 Antibody [NBP1-85551]

Immunocytochemistry/Immunofluorescence: SOX9 Antibody [NBP1-85551] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human colorectal cancer shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human glioma shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human small intestine shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551]

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
Simple Western: SOX9 Antibody [NBP1-85551]

Simple Western: SOX9 Antibody [NBP1-85551]

Simple Western: SOX9 Antibody [NBP1-85551] - Simple Western lane view shows a specific band for SOX9 in 0.1 mg/ml of U-251MG sp (left) and HepG2 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: SOX9 Antibody [NBP1-85551]

Simple Western: SOX9 Antibody [NBP1-85551]

Simple Western: SOX9 Antibody [NBP1-85551] - Electropherogram image(s) of corresponding Simple Western lane view. SOX9 antibody was used at 1:100 dilution on U-251MG sp and HepG2 lysates(s).
SOX9 Antibody

Immunohistochemistry: SOX9 Antibody [NBP1-85551] -

Immunohistochemistry of candidate biomarkers in prostate cancer. Representative immunohistochemical staining of ACPP, ADAM9, ALDH1A2, CASR, CCND1, CCPG1, CD34, CD44, CD44v6, CHGA, CHMP1A, EI24, ENO2, GADD45B, HA, HAS2, HES6, HMMR, HOXC6, HYAL1, IGF1, IQCK, MAP4K4, MKI67, PAGE4, PLIN2, PTEN, SIAH2, SMAD4, SOX9, SPP1, SYP, & TP53 from prostate cancer tissue microarrays. Scale bar represents 50 μm. Image collected & cropped by CiteAb from the following publication (https://bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-244), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SOX9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100br/>In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in U-251MG sp and HepG2, separated by Size, antibody dilution of 1:100, apparent MW was 59 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Reviewed Applications

Read 1 review rated 5 using NBP1-85551 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SOX9

SOX9 is a member of the family of SOX (Sry-type highmobility group box) genes that were first identified on the basis of region with high homology to that of Sry (Sex determining region Y). SOX9 is a transcription factor with a high mobility group DNA-binding domain that is expressed in all prechondrocytic and chondrocytic cells during embryonic development in a pattern that close parallels that of the gene for type II collagen. SOX9 is important in neural crest formation, and is involved in regulating subsequent epithelial-mesenchymal transition and migration.

Long Name

Transcription Factor SOX9

Alternate Names

campomelic dysplasia, autosomal sex-reversal, CMD 1, CMD1, CMPD1, SRA1SRY (sex-determining region Y)-box 9 protein, SRY (sex determining region Y)-box 9, SRY-related HMG-box, gene 9, transcription factor SOX-9

Entrez Gene IDs

6662 (Human)

Gene Symbol

SOX9

UniProt

P48436

Additional SOX9 Products

Product Documents for SOX9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SOX9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SOX9 Antibody - BSA Free

Customer Reviews for SOX9 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used SOX9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • SOX9 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: 293T lysates
    Species: Human
    Verified Customer | Posted 01/30/2019
    There are two bands around 75kd in 293t cells lysates. Green is Sox9 and red is marker.
    SOX9 Antibody - BSA Free NBP1-85551

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies