SUMO1 Antibody (6F8B6)

Novus Biologicals | Catalog # NBP3-15676

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6F8B6 expressed in HEK293
View all SUMO1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-101 of human Sumo 1 (P63165). MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SUMO1 Antibody (6F8B6)

Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676]

Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676]

Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676] - Western blot analysis of extracts of various cell lines, using SUMO1 antibody (NBP3-15676) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676]

Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676]

Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676] - Western blot analysis of extracts of various cell lines, using SUMO1 antibody (NBP3-15676) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676]

Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676]

Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676] - Western blot analysis of extracts of various cell lines, using SUMO1 antibody (NBP3-15676) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.
SUMO1 Antibody (6F8B6)

Immunocytochemistry/ Immunofluorescence: SUMO1 Antibody (6F8B6) [SUMO1] -

Immunocytochemistry/ Immunofluorescence: SUMO1 Antibody (6F8B6) [SUMO1] - Confocal imaging of NIH/3T3 cells using [KO Validated] SUMO1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
SUMO1 Antibody (6F8B6)

Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] -

Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
SUMO1 Antibody (6F8B6)

Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] -

Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
SUMO1 Antibody (6F8B6)

Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] -

Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
SUMO1 Antibody (6F8B6)

Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] -

Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
SUMO1 Antibody (6F8B6)

Western Blot: SUMO1 Antibody (6F8B6) [SUMO1] -

Western Blot: SUMO1 Antibody (6F8B6) [SUMO1] - Western blot analysis of lysates from wild type(WT) and SUMO1 knockout (KO) 293T cells, using [KO Validated] SUMO1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for SUMO1 Antibody (6F8B6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SUMO1

Sumo 1 is a ubiquitin-like protein which binds to a wide range of target proteins. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved in targeting RANGAP1 to the nuclear pore complex protein RANBP2. SUMO 1 is also known to form a complex with RanGAP1.

Long Name

Small Ubiquitin-like Modifier 1

Alternate Names

PIC1, Sentrin, SMT3C, SMT3H3, UBL1

Gene Symbol

SUMO1

Additional SUMO1 Products

Product Documents for SUMO1 Antibody (6F8B6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SUMO1 Antibody (6F8B6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SUMO1 Antibody (6F8B6)

There are currently no reviews for this product. Be the first to review SUMO1 Antibody (6F8B6) and earn rewards!

Have you used SUMO1 Antibody (6F8B6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies