t-Plasminogen Activator/tPA Antibody (10W4L1)

Novus Biologicals | Catalog # NBP3-16356

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10W4L1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 463-562 of human tPA/t-Plasminogen Activator/tPA (P00750). LKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for t-Plasminogen Activator/tPA Antibody (10W4L1)

Western Blot: t-Plasminogen Activator/tPA Antibody (10W4L1) [NBP3-16356]

Western Blot: t-Plasminogen Activator/tPA Antibody (10W4L1) [NBP3-16356]

Western Blot: t-Plasminogen Activator/tPA Antibody (10W4L1) [NBP3-16356] - Western blot analysis of extracts of various cell lines, using tPA/t-Plasminogen Activator/tPA Rabbit mAb (NBP3-16356) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
t-Plasminogen Activator/tPA Antibody (10W4L1)

Immunocytochemistry/Immunofluorescence: t-Plasminogen Activator/tPA Antibody (10W4L1) [NBP3-16356] -

Immunocytochemistry/Immunofluorescence: t-Plasminogen Activator/tPA Antibody (10W4L1) [NBP3-16356] - NIH/3T3 cells using tPA/PLAT Rabbit mAb (at dilution of 1:100) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
t-Plasminogen Activator/tPA Antibody (10W4L1)

Plasminogen Activator/tPA Antibody (10W4L1) [NBP3-16356] -

Confocal imaging of human placenta using tPA/PLAT Rabbit mAb at dilution of 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Applications for t-Plasminogen Activator/tPA Antibody (10W4L1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:100 - 1:400

Immunohistochemistry-Paraffin

1:100 - 1:400

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: t-Plasminogen Activator/tPA

Tissue plasminogen activator (tPA) is a serine protease which converts the abundant proenzyme plasminogen to active plasmin. It plays a key role in thrombolysis (1) and several neurobiological processes (2).

Long Name

Tissue Plasminogen Activator

Alternate Names

Alteplase, PLAT, Reteplase, T-PA, tPlasminogen Activator

Gene Symbol

PLAT

Additional t-Plasminogen Activator/tPA Products

Product Documents for t-Plasminogen Activator/tPA Antibody (10W4L1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for t-Plasminogen Activator/tPA Antibody (10W4L1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for t-Plasminogen Activator/tPA Antibody (10W4L1)

There are currently no reviews for this product. Be the first to review t-Plasminogen Activator/tPA Antibody (10W4L1) and earn rewards!

Have you used t-Plasminogen Activator/tPA Antibody (10W4L1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies