Transgelin/TAGLN/SM22 alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87981

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (97%), Rat (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Transgelin/TAGLN Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25706627).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Transgelin/TAGLN/SM22 alpha Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981]

Immunocytochemistry/ Immunofluorescence: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981]

Immunocytochemistry/Immunofluorescence: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human cell line U-2 OS shows localization to mitochondria & microtubules.
Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981]

Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981]

Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining in human smooth muscle and skeletal muscle tissues using anti-TAGLN antibody. Corresponding TAGLN RNA-seq data are presented for the same tissues.
Transgelin/TAGLN/SM22 alpha Antibody - BSA Free Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody - BSA Free [NBP1-87981]

Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody - BSA Free [NBP1-87981]

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Transgelin/TAGLN/SM22 alpha Antibody - BSA Free Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody - BSA Free [NBP1-87981]

Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody - BSA Free [NBP1-87981]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Transgelin/TAGLN/SM22 alpha Antibody - BSA Free Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody - BSA Free [NBP1-87981]

Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody - BSA Free [NBP1-87981]

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Transgelin/TAGLN/SM22 alpha Antibody - BSA Free Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody - BSA Free [NBP1-87981]

Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody - BSA Free [NBP1-87981]

Staining of human liver shows no positivity in hepatocytes as expected.
Transgelin/TAGLN/SM22 alpha Antibody - BSA Free Western Blot: Transgelin/TAGLN/SM22 alpha Antibody - BSA Free [NBP1-87981]

Western Blot: Transgelin/TAGLN/SM22 alpha Antibody - BSA Free [NBP1-87981]

Analysis in human heart tissue.

Applications for Transgelin/TAGLN/SM22 alpha Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 25706627). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Transgelin/TAGLN

In contrast to fast and slow skeletal muscle cells that fuse and terminally differentiate, smooth muscle cells are able to simultaneously proliferate and express lineage-restricted proteins. One of these proteins, expressed exclusively in smooth muscles, has been referred to as SM22-alpha, a 22 kDa protein with structural similarity to the vertebrate thin filament myofibrillar regulatory protein calponin and the Drosophila muscle protein mp20, neither of which play a direct role in the contractile apparatus.The protein is a transformation and shape-change sensitive actin cross-linking/geling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear.

Alternate Names

SM22 alpha, TAGLN, WS3-10

Gene Symbol

TAGLN

Additional Transgelin/TAGLN Products

Product Documents for Transgelin/TAGLN/SM22 alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Transgelin/TAGLN/SM22 alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Transgelin/TAGLN/SM22 alpha Antibody - BSA Free

Customer Reviews for Transgelin/TAGLN/SM22 alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Transgelin/TAGLN/SM22 alpha Antibody - BSA Free and earn rewards!

Have you used Transgelin/TAGLN/SM22 alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies