YAP1 Antibody (10G4S10)

Novus Biologicals | Catalog # NBP3-15685

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10G4S10 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for YAP1 Antibody (10G4S10)

YAP1 Antibody (10G4S10)

Western Blot: YAP1 Antibody (10G4S10) [YAP1] -

Western Blot: YAP1 Antibody (10G4S10) [YAP1] - Western blot analysis of lysates from wild type (WT) and YAP1 knockout (KO) HeLa cells using [KO Validated] YAP1 Rabbit mAb at 1:10000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
YAP1 Antibody (10G4S10)

Immunocytochemistry/ Immunofluorescence: YAP1 Antibody (10G4S10) [YAP1] -

Immunocytochemistry/ Immunofluorescence: YAP1 Antibody (10G4S10) [YAP1] - Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] YAP1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
YAP1 Antibody (10G4S10)

Immunohistochemistry: YAP1 Antibody (10G4S10) [YAP1] -

Immunohistochemistry: YAP1 Antibody (10G4S10) [YAP1] - Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma tissue using [KO Validated] YAP1 Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
YAP1 Antibody (10G4S10)

Immunohistochemistry: YAP1 Antibody (10G4S10) [YAP1] -

Immunohistochemistry: YAP1 Antibody (10G4S10) [YAP1] - Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] YAP1 Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
YAP1 Antibody (10G4S10)

Immunocytochemistry/ Immunofluorescence: YAP1 Antibody (10G4S10) [YAP1] -

Immunocytochemistry/ Immunofluorescence: YAP1 Antibody (10G4S10) [YAP1] - Immunofluorescence analysis of HeLa cells using [KO Validated] YAP1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
YAP1 Antibody (10G4S10)

Immunohistochemistry: YAP1 Antibody (10G4S10) [YAP1] -

Immunohistochemistry: YAP1 Antibody (10G4S10) [YAP1] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] YAP1 Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
YAP1 Antibody (10G4S10)

Immunohistochemistry: YAP1 Antibody (10G4S10) [YAP1] -

Immunohistochemistry: YAP1 Antibody (10G4S10) [YAP1] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using [KO Validated] YAP1 Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
YAP1 Antibody (10G4S10)

Immunohistochemistry: YAP1 Antibody (10G4S10) [YAP1] -

Immunohistochemistry: YAP1 Antibody (10G4S10) [YAP1] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using [KO Validated] YAP1 Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
YAP1 Antibody (10G4S10)

Immunoprecipitation: YAP1 Antibody (10G4S10) [YAP1] -

Immunoprecipitation: YAP1 Antibody (10G4S10) [YAP1] - Immunoprecipitation analysis of 300 ug extracts of A-549 cells using 3 ug YAP1 antibody. Western blot was performed from the immunoprecipitate using YAP1 antibody at a dilution of 1:500.
YAP1 Antibody (10G4S10)

Immunocytochemistry/ Immunofluorescence: YAP1 Antibody (10G4S10) [YAP1] -

Immunocytochemistry/ Immunofluorescence: YAP1 Antibody (10G4S10) [YAP1] - Immunofluorescence analysis of U20S cells using [KO Validated] YAP1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
YAP1 Antibody (10G4S10)

Immunohistochemistry: YAP1 Antibody (10G4S10) [NBP3-15685] -

Immunohistochemistry: YAP1 Antibody (10G4S10) [NBP3-15685] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] YAP1 Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for YAP1 Antibody (10G4S10)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:100 - 1:500

Western Blot

1:2000 - 1:4000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: YAP1

The transcriptional coactivator Yes-associated protein (YAP), also known as Yes-associated protein 1 (YAP1), Yes-Associated Protein YAP65 Homolog, Protein Yorkie Homolog and YAP65 has a theoretical molecular weight of 65 kDa. The YAP1 gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. YAP1 shares homology with the WW domain of transcriptional co-activator with PDZ-binding motif (TAZ), which functions as a transcriptional co-activator by binding to the PPXY motif present in transcription factors and is likely involved in protein-protein interaction. YAP has been identified as a core regulatory mechanism that blocks mammalian glial cell proliferation and cellular reprogramming following damage (1).

YAP plays a role in the development and progression of multiple cancers as a transcriptional regulator of the Hippo signaling pathway. YAP1 encodes a nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis to play a pivotal role in controlling cell growth and organ size and has emerged as a key player in tumor suppression (2,3). Deregulation of the Hippo pathway causes tumor formation and malignancy, with YAP being a key oncogenic driver in liver carcinogenesis (2) and may function as a potential target for cancer treatment (3).

References

1. Rueda, E. M., Hall, B. M., Hill, M. C., Swinton, P. G., Tong, X., Martin, J. F., & Poche, R. A. (2019). The Hippo Pathway Blocks Mammalian Retinal Muller Glial Cell Reprogramming. Cell Rep, 27(6), 1637-1649.e1636. doi:10.1016/j.celrep.2019.04.047

2. Liu, A. M., Xu, M. Z., Chen, J., Poon, R. T., & Luk, J. M. (2010). Targeting YAP and Hippo signaling pathway in liver cancer. Expert Opin Ther Targets, 14(8), 855-868. doi:10.1517/14728222.2010.499361

3.Ye, S., & Eisinger-Mathason, T. S. (2016). Targeting the Hippo pathway: Clinical implications and therapeutics. Pharmacol Res, 103, 270-278. doi:10.1016/j.phrs.2015.11.025

Long Name

Yes-associated Protein 1

Alternate Names

YAP2, YAP65, YKI, Yorkie Homolog

Gene Symbol

YAP1

Additional YAP1 Products

Product Documents for YAP1 Antibody (10G4S10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for YAP1 Antibody (10G4S10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for YAP1 Antibody (10G4S10)

There are currently no reviews for this product. Be the first to review YAP1 Antibody (10G4S10) and earn rewards!

Have you used YAP1 Antibody (10G4S10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...