5-Lipoxygenase Antibody (5C5Z2)

Novus Biologicals | Catalog # NBP3-16150

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5C5Z2 expressed in HEK293
View all 5-Lipoxygenase Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 5-Lipoxygenase (P09917). CYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for 5-Lipoxygenase Antibody (5C5Z2)

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Western blot analysis of extracts of Raji cells, using 5-Lipoxygenase Rabbit mAb (NBP3-16150) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Immunohistochemistry of paraffin-embedded mouse spleen using 5-Lipoxygenase Rabbit mAb (NBP3-16150) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Western blot analysis of extracts of Rat lung, using 5-Lipoxygenase Rabbit mAb (NBP3-16150) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150]

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Immunohistochemistry of paraffin-embedded human appendix using 5-Lipoxygenase Rabbit mAb (NBP3-16150) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
5-Lipoxygenase Antibody (5C5Z2)

Immunocytochemistry/ Immunofluorescence: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] -

Immunocytochemistry/ Immunofluorescence: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Confocal imaging of U-2 OS cells using 5-Lipoxygenase Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Applications for 5-Lipoxygenase Antibody (5C5Z2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:100 - 1:400

Immunohistochemistry

1:100 - 1:1000

Immunohistochemistry-Paraffin

1:100 - 1:1000

Western Blot

1:1000 - 1:4000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: 5-Lipoxygenase

5 Lipoxygenase encodes a protein which, with Arachidonate 5-lipoxygenase-activating protein, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation.

Alternate Names

5Lipoxygenase, 5LPG, ALOX5, LOG5, LOX5A

Gene Symbol

ALOX5

Additional 5-Lipoxygenase Products

Product Documents for 5-Lipoxygenase Antibody (5C5Z2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 5-Lipoxygenase Antibody (5C5Z2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 5-Lipoxygenase Antibody (5C5Z2)

There are currently no reviews for this product. Be the first to review 5-Lipoxygenase Antibody (5C5Z2) and earn rewards!

Have you used 5-Lipoxygenase Antibody (5C5Z2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies