AKT3 Antibody (6E11) - Azide and BSA Free
Novus Biologicals | Catalog # H00010000-M08
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Sandwich ELISA, Proximity Ligation Assay
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 6E11
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
AKT3 (AAD29089, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
Specificity
AKT3 - v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Scientific Data Images for AKT3 Antibody (6E11) - Azide and BSA Free
Western Blot: AKT3 Antibody (6E11) [H00010000-M08]
Western Blot: Akt3 Antibody (6E11) [H00010000-M08] - Analysis of AKT3 expression in K-562 (Cat # L009V1).Western Blot: AKT3 Antibody (6E11) [H00010000-M08]
Western Blot: Akt3 Antibody (6E11) [H00010000-M08] - Analysis of AKT3 expression in HeLa (Cat # L013V1).Western Blot: AKT3 Antibody (6E11) [H00010000-M08]
Western Blot: Akt3 Antibody (6E11) [H00010000-M08] - Analysis of AKT3 expression in PC-12 (Cat # L012V1).Western Blot: AKT3 Antibody (6E11) [H00010000-M08]
Western Blot: Akt3 Antibody (6E11) [H00010000-M08] - Analysis of AKT3 expression in Raw 264.7 (Cat # L024V1).Western Blot: AKT3 Antibody (6E11) [H00010000-M08]
Western Blot: Akt3 Antibody (6E11) [H00010000-M08] - Analysis of AKT3 expression in MCF-7 (Cat # L046V1).Western Blot: AKT3 Antibody (6E11) [H00010000-M08]
Western Blot: Akt3 Antibody (6E11) [H00010000-M08] - Analysis of AKT3 expression in NIH/3T3 (Cat # L018V1).Western Blot: AKT3 Antibody (6E11) [H00010000-M08]
Western Blot: Akt3 Antibody (6E11) [H00010000-M08] - Analysis of AKT3 expression in transfected 293T cell line by AKT3 monoclonal antibody (M08), clone 6E11. Lane 1: AKT3 transfected lysatE (55.8 KDa). Lane 2: Non-transfected lysate.Proximity Ligation Assay: AKT3 Antibody (6E11) [H00010000-M08]
Proximity Ligation Assay: Akt3 Antibody (6E11) [H00010000-M08] - Analysis of protein-protein interactions between PRKCZ and AKT3. HeLa cells were stained with anti-PRKCZ rabbit purified polyclonal 1:1200 and anti-AKT3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction c
Sandwich ELISA: Akt3 Antibody (6E11) [H00010000-M08] - Detection limit for recombinant GST tagged AKT3 is approximately 0.03ng/ml as a capture antibody.
Applications for AKT3 Antibody (6E11) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: Akt3
The main function of AKT is to control inhibition of apoptosis and promote cell proliferation. Survival factors can activate AKT Ser473 and Thr308 phosphorylation sites in a transcription-independent manner, resulting in the inactivation of apoptotic signaling transduction through the tumor suppressor PTEN, an antagonist to PI3-K (5). PTEN exerts enzymatic activity as a phosphatidylinositol-3,4,5-trisphosphate (PIP3) phosphatase, opposing PI3K activity by decreasing availability of PIP3 to proliferating cells, leading to overexpression and inappropriate activation of AKT noted in many types of cancer.
AKT1 function has been linked to overall physiological growth and function (2). AKT1 has been correlated with proteus syndrome, a rare disorder characterized by overgrowth of various tissues caused by a mosaic variant in the AKT1 gene in humans.
AKT2 is strongly correlated with Type II diabetes, including phenotypes of insulin resistance, hyperglycemia and atherosclerosis (2, 6).
The function of AKT3 is specifically associated to brain development, where disruptions to AKT3 are correlated with microcephaly, hemimegalencephaly, megalencephaly and intellectual disabilities (2).
References
1. Ersahin, T., Tuncbag, N., & Cetin-Atalay, R. (2015). The PI3K/AKT/mTOR interactive pathway. Mol Biosyst, 11(7), 1946-1954. doi:10.1039/c5mb00101c
2. Cohen, M. M., Jr. (2013). The AKT genes and their roles in various disorders. Am J Med Genet A, 161a(12), 2931-2937. doi:10.1002/ajmg.a.36101
3. Georgescu, M. M. (2010). PTEN Tumor Suppressor Network in PI3K-Akt Pathway Control. Genes Cancer, 1(12), 1170-1177. doi:10.1177/1947601911407325
4. Mishra, P., Paital, B., Jena, S., Swain, S. S., Kumar, S., Yadav, M. K.,... Samanta, L. (2019). Possible activation of NRF2 by Vitamin E/Curcumin against altered thyroid hormone induced oxidative stress via NFkB/AKT/mTOR/KEAP1 signalling in rat heart. Sci Rep, 9(1), 7408. doi:10.1038/s41598-019-43320-5
5. Wedel, S., Hudak, L., Seibel, J. M., Juengel, E., Oppermann, E., Haferkamp, A., & Blaheta, R. A. (2011). Critical analysis of simultaneous blockage of histone deacetylase and multiple receptor tyrosine kinase in the treatment of prostate cancer. Prostate, 71(7), 722-735. doi:10.1002/pros.21288
6. Rotllan, N., Chamorro-Jorganes, A., Araldi, E., Wanschel, A. C., Aryal, B., Aranda, J. F.,... Fernandez-Hernando, C. (2015). Hematopoietic Akt2 deficiency attenuates the progression of atherosclerosis. Faseb j, 29(2), 597-610. doi:10.1096/fj.14-262097
Long Name
v-Akt Murine Thymoma Viral Oncogene Homolog 3
Alternate Names
PKB gamma, RAC-gamma
Entrez Gene IDs
10000 (Human)
Gene Symbol
AKT3
UniProt
Additional Akt3 Products
Product Documents for AKT3 Antibody (6E11) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for AKT3 Antibody (6E11) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for AKT3 Antibody (6E11) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review AKT3 Antibody (6E11) - Azide and BSA Free and earn rewards!
Have you used AKT3 Antibody (6E11) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...
Associated Pathways
IL-2 Signaling Pathways
IL-4 Signaling Pathways
IL-7 Signaling Pathways
IL-9 Signaling Pathways
IL-15 Signaling Pathways
IL-21 Signaling Pathways
mTOR Signaling Pathway
Notch Signaling Pathways
TGF-beta Signaling Pathways
VEGF - VEGF R2 Signaling Pathways