AMPK beta 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92961

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human AMPK beta 1 (NP_006244.2). MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for AMPK beta 1 Antibody - BSA Free

Western Blot: AMPK beta 1 AntibodyBSA Free [NBP2-92961]

Western Blot: AMPK beta 1 AntibodyBSA Free [NBP2-92961]

Western Blot: AMPK beta 1 Antibody [NBP2-92961] - Analysis of extracts of various cell lines, using AMPK beta 1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody - BSA Free [NBP2-92961]

Immunocytochemistry/ Immunofluorescence: AMPK beta 1 Antibody - BSA Free [NBP2-92961]

Immunocytochemistry/Immunofluorescence: AMPK beta 1 Antibody [NBP2-92961] - Analysis of NIH-3T3 cells using AMPK beta 1. Blue: DAPI for nuclear staining.
Knockout Validated: AMPK beta 1 Antibody - BSA Free [NBP2-92961]

Western Blot: AMPK beta 1 Antibody - BSA Free [NBP2-92961]

Western Blot: AMPK beta 1 Antibody [NBP2-92961] - Analysis of extracts from normal (control) and AMPK beta 1 knockout (KO) HeLa cells, using AMPK beta 1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk

Applications for AMPK beta 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AMPK beta 1

The 5'-AMP-activated protein kinase (AMPK), a member of the SNF1 (sucrose non-fermentor) kinase family (1). AMPK is a heterotrimeric protein comprising alpha (63 kDa), beta (38 kDa) and gamma (38 kDa) subunits (2). The alpha subunit is the catalytic subunit, while beta and gamma are non-catalytic subunits, although they have been found to interact with the active subunit in liver. AMPK regulates fatty acid and sterol synthesis by phosphorylation of acetyl-CoA as well as cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase (3). AMPK beta-1 mediates the association of the AMPK heterotrimeric complex in vitro (2). Two isoforms have been found and the difference in expression patterns indicates tissue-specific roles for these isoforms (4).

Long Name

AMP-activated Protein Kinase beta 1

Alternate Names

PRKAB1

Gene Symbol

PRKAB1

Additional AMPK beta 1 Products

Product Documents for AMPK beta 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AMPK beta 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for AMPK beta 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AMPK beta 1 Antibody - BSA Free and earn rewards!

Have you used AMPK beta 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies