CXCL8/IL-8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33819

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CXCL8/IL-8 Antibody - BSA Free

Western Blot: CXCL8/IL-8 Antibody [NBP2-33819]

Western Blot: CXCL8/IL-8 Antibody [NBP2-33819]

Western Blot: CXCL8/IL-8 Antibody [NBP2-33819] - Analysis in human cell line EFO-21.
Immunocytochemistry/ Immunofluorescence: CXCL8/IL-8 Antibody [NBP2-33819]

Immunocytochemistry/ Immunofluorescence: CXCL8/IL-8 Antibody [NBP2-33819]

Immunocytochemistry/Immunofluorescence: CXCL8/IL-8 Antibody [NBP2-33819] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819]

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819]

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819] - Staining of human rectum shows moderate positivity in plasma.
Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819]

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819]

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819] - Staining of human fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819]

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819]

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819] - Staining of human lymph node shows weak to moderate cytoplasmic positivity in a subset of non-germinal center cells.
Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819]

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819]

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819] - Staining of human placenta shows moderate positivity in plasma.
CXCL8/IL-8 Antibody - BSA Free

Western Blot: CXCL8/IL-8 Antibody - BSA Free [NBP2-33819] -

(A, B) mRNA expression changes of acne inflammatory markers in sqRT-PCR. The reduction of inflammatory markers was large in the PDT group in which FDT gel and LED irradiation were applied together, in particular, it was greatest in the group in which LED irradiation was applied for 15 minutes. (C, D) Protein expression changes of acne inflammatory markers as indicated by Western blot analysis. The reduction of inflammatory markers was large in the PDT group in which FDT gel and LED irradiation were applied together; in particular, the greatest change was in the group in which LED irradiation was applied for 15 minutes. (B, D) * indicates p<0.05 statistical significance.IL: interleukin, TNF: tumor necrosis factor, TLR: Toll-like receptor, MMP: matrix metalloproteinase. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39623608), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CXCL8/IL-8 Antibody - BSA Free

Western Blot: CXCL8/IL-8 Antibody - BSA Free [NBP2-33819] -

(A, B) mRNA expression changes of acne inflammatory markers in sqRT-PCR. The reduction of inflammatory markers was large in the PDT group in which FDT gel and LED irradiation were applied together, in particular, it was greatest in the group in which LED irradiation was applied for 15 minutes. (C, D) Protein expression changes of acne inflammatory markers as indicated by Western blot analysis. The reduction of inflammatory markers was large in the PDT group in which FDT gel and LED irradiation were applied together; in particular, the greatest change was in the group in which LED irradiation was applied for 15 minutes. (B, D) * indicates p<0.05 statistical significance.IL: interleukin, TNF: tumor necrosis factor, TLR: Toll-like receptor, MMP: matrix metalloproteinase. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39623608), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CXCL8/IL-8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-8/CXCL8

IL8 is a member of the CXC chemokine family. This family of small basic heparan-binding proteins are proinflammatory and primarily mediate the activation and migration of neutrophils into tissue from peripheral blood. This chemokine is one of the major mediators of the inflammatory response and is secreted by several cell types in response to an inflammatory stimulus. It functions as a chemoattractant, and is also a potent angiogenic factor. IL8 attracts neutrophils, basophils, and T-cells, but not monocytes. Cystic fibrosis (CF) is characterized by severe lung inflammation. The inflammatory process is believed to be caused by massive overproduction of the proinflammatory protein IL8, and the high levels of IL8 in the CF lung are therefore believed to be the central mechanism behind CF lung pathophysiology.

Long Name

Interleukin 8

Alternate Names

CXCL8, GCP1, IL8, LAI, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP1, NCF, TCF, TSG1

Gene Symbol

CXCL8

UniProt

Additional IL-8/CXCL8 Products

Product Documents for CXCL8/IL-8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CXCL8/IL-8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CXCL8/IL-8 Antibody - BSA Free

Customer Reviews for CXCL8/IL-8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CXCL8/IL-8 Antibody - BSA Free and earn rewards!

Have you used CXCL8/IL-8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CXCL8/IL-8 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Are mouse or rat CXCL8/IL-8 products offered?

    A: Mouse and rat do not have a gene which encodes CXCL8/IL-8. In mouse, the functional homologs to human CXCL8/IL-8 are CXCL1/KC and CXCL2/MIP-2. In rat, the functional homolog to CXCL8/human IL-8 is CXCL3/CINC-2.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies