ERK1 Inhibitor Peptide Set
Novus Biologicals | Catalog # NBP2-29333
Loading...
Key Product Details
Species
Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Loading...
Product Specifications
Specificity
The ERK inhibitory peptide also contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable.
The control peptide consists of only the PTD sequence.
The control peptide consists of only the PTD sequence.
Application Notes
Inhibition of Erk activation.
The inhibitor peptide is to block ERK activation by MEK. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point.
Please refer to Kalemen et al (2002) for additional information about how the inhibitor peptide has been used to block ERK activation by MEK.
The inhibitor peptide is to block ERK activation by MEK. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point.
Please refer to Kalemen et al (2002) for additional information about how the inhibitor peptide has been used to block ERK activation by MEK.
Reactivity Notes
Broad; the peptide sequence is 100% conserved among multiple species.
Inhibitor Content
ERK Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795.
Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Formulation, Preparation, and Storage
Preparation Method
Preparation of 5 mM Stock Solutions
PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps.
ERK Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN
Add 53 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.
Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK
Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
-8g of NaCl
-0.2g of KCl
-1.44g of Na2HPO4
-0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving.
Please contact technical support for detailed reconstitution instructions.
PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps.
ERK Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN
Add 53 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.
Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK
Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
-8g of NaCl
-0.2g of KCl
-1.44g of Na2HPO4
-0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving.
Please contact technical support for detailed reconstitution instructions.
Concentration
Lyoph
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: ERK1
Long Name
Extracellular Signal-regulated Kinase 1
Alternate Names
MAPK3, P44ERK1, p44mapk, PRKM3
Gene Symbol
MAPK3
Additional ERK1 Products
Product Documents for ERK1 Inhibitor Peptide Set
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ERK1 Inhibitor Peptide Set
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.
Customer Reviews for ERK1 Inhibitor Peptide Set
There are currently no reviews for this product. Be the first to review ERK1 Inhibitor Peptide Set and earn rewards!
Have you used ERK1 Inhibitor Peptide Set?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
View specific protocols for ERK1 Inhibitor Peptide Set (NBP2-29333):
ERK1 Inhibitor Peptide Set:
Hazard Information
Chemical Name: Non hazardous products
Chemical Formula: N/A
CAS Number: N/A
EEC-No: N/A
Hazard Identification
None
First Aid Measures
Eye Contact: None
Skin Contact: None
Inhalation: None
Ingestion: None
Accidental Release Measures
This product either does not contain hazardous constituents or the concentration of all chemical constituents are below the regulatory threshold limits described by Occupational Safety Health Administration Hazard Communication Standard 29 CFR 1910.1200 and the European Directive 91/155/EEC. 88/379/EEC, and 67/546/EEC.
Handling and Storage
Exposure Controls / Personal Protection
Other Precautions: None
Physical and Chemical Properties
Form: N/A
Color: N/A
Odor: N/A
Melting Point: N/A
Boiling Temperature: N/A
Density: N/A
Vapor Pressure: N/A
Solubility in Water: N/A
Flash Point: N/A
Explosion limits: N/A
Ignition Temperature: N/A
Hazard Information
Chemical Name: Non hazardous products
Chemical Formula: N/A
CAS Number: N/A
EEC-No: N/A
Hazard Identification
None
First Aid Measures
Eye Contact: None
Skin Contact: None
Inhalation: None
Ingestion: None
Accidental Release Measures
This product either does not contain hazardous constituents or the concentration of all chemical constituents are below the regulatory threshold limits described by Occupational Safety Health Administration Hazard Communication Standard 29 CFR 1910.1200 and the European Directive 91/155/EEC. 88/379/EEC, and 67/546/EEC.
Handling and Storage
Exposure Controls / Personal Protection
Other Precautions: None
Physical and Chemical Properties
Form: N/A
Color: N/A
Odor: N/A
Melting Point: N/A
Boiling Temperature: N/A
Density: N/A
Vapor Pressure: N/A
Solubility in Water: N/A
Flash Point: N/A
Explosion limits: N/A
Ignition Temperature: N/A
Loading...
Associated Pathways
IL-4 Signaling Pathways
IL-7 Signaling Pathways
IL-9 Signaling Pathways
IL-15 Signaling Pathways
IL-17 Family Signaling Pathways
IL-21 Signaling Pathways
MAPK Signaling: Oxidative Stress Pathway
MAPK Signaling Pathway: Mitogen Stimulation Pathway
mTOR Signaling Pathway
NOD-like Receptor Signaling Pathways
Pathogen or Damage-activated C-Type Lectin Receptor Signaling Pathways
TGF-beta Signaling Pathways
VEGF - VEGF R2 Signaling Pathways